Is there an issue? Send a MessageReason:
None
Changed line(s) 566 (click to see context) from:
'''[[Main/{{Warhammer40000}} Vulkan (Primarch)]], God of Main/[[{{ScaryBlackMan}} Scary Black Men]]'''
to:
'''[[Main/{{Warhammer40000}} Vulkan (Primarch)]], God of Main/[[{{ScaryBlackMan}} Scary {{Scary Black Men]]'''M|an}}en'''
Is there an issue? Send a MessageReason:
None
Changed line(s) 791 (click to see context) from:
'''[[Main/AssassinsCreed Altaïr ibn La-Ahad]], God of [[Main/CareerKillers Assassins]]''' (Assassin, Desmond Miles)
to:
Changed line(s) 797,798 (click to see context) from:
* Threat Level to Melkor: Low until he check's off everyone from his hit list. Then it get's to EXTREME as his reputation explains for itself.
to:
* Threat Level to Melkor: Low until he check's checks off everyone from his hit list. Then it get's to EXTREME as his reputation explains for itself.
Is there an issue? Send a MessageReason:
Big text was removed from wiki markup a few weeks back.
Changed line(s) 614 (click to see context) from:
'''[+[[Main/{{Disgaea}} Captain Gordon]], Defender of Earth!+]'''
to:
Changed line(s) 618,620 (click to see context) from:
* Reason for joining: [+Captain Gordon, Defender of Earth!+] doesn't need a reason to defend justice!
* Loyalty to Cosmos: [+Captain Gordon, Defender of Earth!+] will stick with Cosmos like a mud! Because that's what heroes do! '''HAAAAHAHAHAHAHAHAHA!!!!'''
* Message for the GUAE: "Fear not, fellow good men! [+Captain Gordon, Defender of Earth!+] eats the GUAE for breakfast!"
* Loyalty to Cosmos: [+Captain Gordon, Defender of Earth!+] will stick with Cosmos like a mud! Because that's what heroes do! '''HAAAAHAHAHAHAHAHAHA!!!!'''
* Message for the GUAE: "Fear not, fellow good men! [+Captain Gordon, Defender of Earth!+] eats the GUAE for breakfast!"
to:
* Reason for joining: [+Captain '''Captain Gordon, Defender of Earth!+] Earth!''' doesn't need a reason to defend justice!
* Loyalty to Cosmos:[+Captain '''Captain Gordon, Defender of Earth!+] Earth!''' will stick with Cosmos like a mud! Because that's what heroes do! '''HAAAAHAHAHAHAHAHAHA!!!!'''
* Message for the GUAE: "Fear not, fellow good men![+Captain '''Captain Gordon, Defender of Earth!+] Earth!''' eats the GUAE for breakfast!"
* Loyalty to Cosmos:
* Message for the GUAE: "Fear not, fellow good men!
Is there an issue? Send a MessageReason:
None
Changed line(s) 574 (click to see context) from:
'''[[Main/{{DawnOfWar}} Cyrus]], God of Main/[[{{DifficultButAwesome}} Hard to use but very powerful characters]]'''
to:
'''[[Main/{{DawnOfWar}} Cyrus]], God of Main/[[{{DifficultButAwesome}} [[DifficultButAwesome Hard to use but very powerful characters]]'''
Is there an issue? Send a MessageReason:
We don\'t need the Commanders here AS well, do we?
Deleted line(s) 221,228 (click to see context) :
'''[[MobileSuitGundam Bright Noa]], [[GetAHoldOfYourselfMan Eternal Repairer of Wrongly Placed Emotions]]'''
* Lesser God
* Symbol: Londo Bell logo
* Alignment: LawfulGood
* Reason for joining: Keeping morale up.
* Loyalty to Cosmos: He helps Cosmos in making sure morale stays high, as he knows that sometimes even the good guys falter, and she appreciates the help.
* Threat level to Melkor: High. Bright is the reason why Melkor can't seem to break the morale of many of the GUAG members...
* Lesser God
* Symbol: Londo Bell logo
* Alignment: LawfulGood
* Reason for joining: Keeping morale up.
* Loyalty to Cosmos: He helps Cosmos in making sure morale stays high, as he knows that sometimes even the good guys falter, and she appreciates the help.
* Threat level to Melkor: High. Bright is the reason why Melkor can't seem to break the morale of many of the GUAG members...
Changed line(s) 342,344 (click to see context) from:
'''[[Main/AvatarTheLastAirbender Iroh]], God of [[SpotOfTea Tea]] and Main/{{Cool Old Guy}}s''' (General Iroh, Dragon of the West)
* Intermediate God
* Symbol: A teapot
* Intermediate God
* Symbol: A teapot
to:
*
* Symbol: A
Deleted line(s) 346,353 (click to see context) :
* Reason for Joining: Godot likes coffee, he likes tea. Together, TheyFightCrime!
* Loyalty to Cosmos: She likes tea and doing the right thing. Loyalty strong and confirmed.
* Threat Level to Melkor: Fairly high. Melkor's seen what Iroh can do when pushed.
'''Main/{{Popeye}}, God of Main/{{Trademark Favorite Food}}s''' (The Sailor Man)
* Greater God
* Symbol: A can of spinach
* Alignment: NeutralGood
* Loyalty to Cosmos: She likes tea and doing the right thing. Loyalty strong and confirmed.
* Threat Level to Melkor: Fairly high. Melkor's seen what Iroh can do when pushed.
'''Main/{{Popeye}}, God of Main/{{Trademark Favorite Food}}s''' (The Sailor Man)
* Greater God
* Symbol: A can of spinach
* Alignment: NeutralGood
Deleted line(s) 394,401 (click to see context) :
'''[[{{Discworld}} Commander Samuel Vimes]], God of Policemen''' (Sam, Old Stoneface, His Grace.)
* Lesser God
* Symbol: A copper badge in the shape of a shield with the number 177 on it.
* Alignment: Chaotic Lawful Good.
* Reason for Joining: First, Carcer is among them, and he ''will'' be brought to justice for his crimes. Second, the GUAE tramples on law and order, and he's going to spread around his anger about that with a big shovel.
* Loyalty to Cosmos: He's loyal to enforcing the law and justice, not her (as he has a bit of contempt for serving any deity, even though he is one). However, he does realize the GUAE are threatening law and order, and is helping Cosmos because as a copper, it's what he supposed to do.
* Threat Level to Melkor: High. Sam has fought off beings of pure evil successfully with no other power than his own will, which concerns Melkor greatly.
* Lesser God
* Symbol: A copper badge in the shape of a shield with the number 177 on it.
* Alignment: Chaotic Lawful Good.
* Reason for Joining: First, Carcer is among them, and he ''will'' be brought to justice for his crimes. Second, the GUAE tramples on law and order, and he's going to spread around his anger about that with a big shovel.
* Loyalty to Cosmos: He's loyal to enforcing the law and justice, not her (as he has a bit of contempt for serving any deity, even though he is one). However, he does realize the GUAE are threatening law and order, and is helping Cosmos because as a copper, it's what he supposed to do.
* Threat Level to Melkor: High. Sam has fought off beings of pure evil successfully with no other power than his own will, which concerns Melkor greatly.
Deleted line(s) 495,502 (click to see context) :
'''[[Main/StarWars Obi-Wan Kenobi]], God of [[Main/TheObiWan Mentors]]''' (Ben Kenobi, Old Ben, OB-1)
* Lesser God
* Symbol: A lightsaber
* Alignment: LawfulGood
* Reason for Joining: He's a Jedi, and the GUAE have Sith; it's pretty straightforward, really.
* Loyalty to Cosmos: The Sith are the upper ranks of the GUAE, and he told Cosmos he was assisting her because he know how to deal with the Sith. She's rather grateful.
* Threat Level to Melkor: Fairly high. Melkor knows of Kenobi's reputation.
* Lesser God
* Symbol: A lightsaber
* Alignment: LawfulGood
* Reason for Joining: He's a Jedi, and the GUAE have Sith; it's pretty straightforward, really.
* Loyalty to Cosmos: The Sith are the upper ranks of the GUAE, and he told Cosmos he was assisting her because he know how to deal with the Sith. She's rather grateful.
* Threat Level to Melkor: Fairly high. Melkor knows of Kenobi's reputation.
Deleted line(s) 551,558 (click to see context) :
'''[[PowerRangers Tommy Oliver]], God of {{Sixth Ranger}}s''' (Dr. Tommy Oliver, Jeebus)
* Lesser God
* Symbol: Ranger helmet (either green, white, red or black)
* Alignment: LawfulGood
* Reason for Joining: Maybe, if he helps quash the forces of evil this one last time, Fate will finally let him retire and get back to teaching. [[spoiler: It won't.]]
* Loyalty to Cosmos: She's a good guy, and the forces of good need the help. He's loyal.
* Threat Level to Melkor: High. A close ally of the Super Sentai, and commands the American Ranger Battalion.
* Lesser God
* Symbol: Ranger helmet (either green, white, red or black)
* Alignment: LawfulGood
* Reason for Joining: Maybe, if he helps quash the forces of evil this one last time, Fate will finally let him retire and get back to teaching. [[spoiler: It won't.]]
* Loyalty to Cosmos: She's a good guy, and the forces of good need the help. He's loyal.
* Threat Level to Melkor: High. A close ally of the Super Sentai, and commands the American Ranger Battalion.
Deleted line(s) 768,774 (click to see context) :
'''Main/CaptainAmerica, God of Justice and Head of Defense''' (Cap, Steve Rogers)
* Intermediate God
* Symbol: The American Flag; razor-edged [[PrecisionGuidedBoomerang boomerang]] shield
* Alignment: Good - there are arguments for both Lawful and Neutral.
* Reason for joining: To defend America and assist his old buddy Iron Man.
* Loyalty to Cosmos: Loyalty is part of the virtues of America, so he's loyal.
* Intermediate God
* Symbol: The American Flag; razor-edged [[PrecisionGuidedBoomerang boomerang]] shield
* Alignment: Good - there are arguments for both Lawful and Neutral.
* Reason for joining: To defend America and assist his old buddy Iron Man.
* Loyalty to Cosmos: Loyalty is part of the virtues of America, so he's loyal.
Deleted line(s) 814,821 (click to see context) :
'''[[Main/MahouSenseiNegima Yue Ayase]], Goddesses of [[Main/TeenGenius Intelligent]] [[Main/BlackMagicianGirl Magical]] [[Main/XanatosGambit Strategy]]''' (Philosophastra Illustrans)
* Lesser Goddess
* Symbol: Juice Box
* Alignment: LawfulGood
* Reason for Joining: She arrived as one of Negi's support mages... and love interests.
* Loyalty to Cosmos: Whom Negi follows, so does she.
* Threat Level to Melkor: Moderate. She's no powerhouse but she's got the textbook equivalent of the Internet at her fingertips and is pretty handy on a broom.
* Lesser Goddess
* Symbol: Juice Box
* Alignment: LawfulGood
* Reason for Joining: She arrived as one of Negi's support mages... and love interests.
* Loyalty to Cosmos: Whom Negi follows, so does she.
* Threat Level to Melkor: Moderate. She's no powerhouse but she's got the textbook equivalent of the Internet at her fingertips and is pretty handy on a broom.
Changed line(s) 957,959 (click to see context) from:
'''[[MahouSenseiNegima Negi Springfield]], God of [[CuteShotaroBoy Juvenile]] {{Chick Magnet}}s''' (Negi-bozu)
* Lesser God
* Symbol: A deck of [[strike: 31]] 29 Pactio cards
* Lesser God
* Symbol: A deck of [[strike: 31]] 29 Pactio cards
to:
* Lesser
* Symbol:
Deleted line(s) 961,968 (click to see context) :
* Reason for Joining: It's the right thing to do.
* Loyalty to Cosmos: Cosmos promised him information on his [[MissingMom mother]] & [[DisappearedDad father]].
* Threat Level to Melkor: High due to magical skill and raw power.
'''[[SuperRobotWars Excellen Browning]], Goddess of [[TheTease Love Innuendo and Teasing]]''' (Ex-neesama, Miss Excell)
* Lesser Goddess
* Symbol: Chibi-Weissritter with a heart sign nearby. Or a set of bunny suit.
* Alignment: LawfulGood
* Loyalty to Cosmos: Cosmos promised him information on his [[MissingMom mother]] & [[DisappearedDad father]].
* Threat Level to Melkor: High due to magical skill and raw power.
'''[[SuperRobotWars Excellen Browning]], Goddess of [[TheTease Love Innuendo and Teasing]]''' (Ex-neesama, Miss Excell)
* Lesser Goddess
* Symbol: Chibi-Weissritter with a heart sign nearby. Or a set of bunny suit.
* Alignment: LawfulGood
Deleted line(s) 1077,1084 (click to see context) :
'''Comicbook/{{Batman}}, God of [[Main/CrazyPrepared Preparations]]''' (The Dark Knight, The Goddamn Batman)
* Intermediate God
* Symbol: The Main/BatSignal
* Alignment: NeutralGood
* Reason for Joining: Because it's right. And because he's the '''''Goddamn''''' Batman.
* Loyalty to Cosmos: High.
* Threat level to Melkor: High. Same reason like Cap, and even bigger, since [[MemeticBadass Batman can beat mostly anyone if he has prep time]].
* Intermediate God
* Symbol: The Main/BatSignal
* Alignment: NeutralGood
* Reason for Joining: Because it's right. And because he's the '''''Goddamn''''' Batman.
* Loyalty to Cosmos: High.
* Threat level to Melkor: High. Same reason like Cap, and even bigger, since [[MemeticBadass Batman can beat mostly anyone if he has prep time]].
Changed line(s) 1340,1342 (click to see context) from:
'''[[WaltDisney Mickey Mouse]], God of {{Toon}}s''' (King Mickey, Mortimer Mouse)
* Greater God
* Symbol: A silhouette of his head
* Greater God
* Symbol: A silhouette of his head
to:
*
* Symbol:
Deleted line(s) 1344,1351 (click to see context) :
* Reason for Joining: To protect his kingdom, and because as one of the few Keyblade wielders, he's desperately needed if and when the GUAE use Heartless.
* Loyalty to Cosmos: Is returning the favor to Cosmos, after she gave him help in the form of some of her champions.
* Threat Level to Melkor: High. It is amazing what you can do with a [[{{Disney/Fantasia}} hat]], a [[KingdomHearts rather large Key]] and a [[EpicMickey paintbrush]] when [[LetsGetDangerous pressed.]]
'''[[{{Warcraft}} Thrall]], God of [[OurOrcsAreDifferent Orcs]]''' (Son of Durotan, Go'el, Warchief)
* Intermediate God
* Symbol: The emblem of the Horde
* Alignment: LawfulGood
* Loyalty to Cosmos: Is returning the favor to Cosmos, after she gave him help in the form of some of her champions.
* Threat Level to Melkor: High. It is amazing what you can do with a [[{{Disney/Fantasia}} hat]], a [[KingdomHearts rather large Key]] and a [[EpicMickey paintbrush]] when [[LetsGetDangerous pressed.]]
'''[[{{Warcraft}} Thrall]], God of [[OurOrcsAreDifferent Orcs]]''' (Son of Durotan, Go'el, Warchief)
* Intermediate God
* Symbol: The emblem of the Horde
* Alignment: LawfulGood
Deleted line(s) 1452,1460 (click to see context) :
'''[[Main/{{Narnia}} Aslan]], God of [[Main/CrystalDragonJesus Religious Metaphors]]''' (King Of Beasts, The Lion, The Lamb)
* Greater God
* Symbol: A White Lamb...no, wait, a Lion...no wait, a lamb!
* Alignment: Lawful Good
* Reason for Joining: It was foretold at the beginning of all things.
* Loyalty to Cosmos: Very strong.
* Threat Level to Melkor: High.
Deleted line(s) 1565,1572 (click to see context) :
'''[[{{Transformers}} Optimus Prime]], God of Mecha''' (Peterbilt, Peter Cullen, [[TransformersGeneration1 TRUKK]], Optronix, Orion Pax)
* Lesser God... apparently. He goes toe-to-toe with some Greater Gods without coming off second best.
* Symbol: The Autobot emblem
* Alignment: LawfulGood
* Reason for Joining: Because freedom is the right of all sentient beings, and the GUAE would take away that freedom.
* Loyalty to Cosmos: High
* Threat Level to Melkor: Fairly High; Melkor remembers what happened to Megatron, Starscream, Grindor, and The Fallen last time Optimus cut loose.
* Lesser God... apparently. He goes toe-to-toe with some Greater Gods without coming off second best.
* Symbol: The Autobot emblem
* Alignment: LawfulGood
* Reason for Joining: Because freedom is the right of all sentient beings, and the GUAE would take away that freedom.
* Loyalty to Cosmos: High
* Threat Level to Melkor: Fairly High; Melkor remembers what happened to Megatron, Starscream, Grindor, and The Fallen last time Optimus cut loose.
Deleted line(s) 1581,1588 (click to see context) :
'''[[FantasticFour Reed Richards]], God of Comic Book Science.'''
* Intermediate God
* Symbol: A circle with a four in it.
* Alignment: NeutralGood
* Reason for Joining: Its the right thing to do, and like Tony he feels the need to make up for his actions during the Civil War.
* Loyalty to Cosmos:
* Threat Level to Melkor: Moderate-low, hem may have superpowers, range, and high resistance to bludgeons, but, after all, ReedRichardsIsUseless.
* Intermediate God
* Symbol: A circle with a four in it.
* Alignment: NeutralGood
* Reason for Joining: Its the right thing to do, and like Tony he feels the need to make up for his actions during the Civil War.
* Loyalty to Cosmos:
* Threat Level to Melkor: Moderate-low, hem may have superpowers, range, and high resistance to bludgeons, but, after all, ReedRichardsIsUseless.
Deleted line(s) 1694,1702 (click to see context) :
'''[[Main/SailorMoon Setsuna Meio]], Guardian of the Gates of Time''' (Sailor Pluto, Trista)
* Lesser Goddess
* Symbol: The Time Staff
* Alignment: LawfulGood
* Allies: The Sailor Senshi
* Reasong for joining: To ensure that nobody abuses the Gates of Time. And she'd like to make herself known after [[PlutoIsExpendable Pluto is no longer considered a planet]].
* Loyalty to Cosmos: High. Cosmos opposes those who would abuse time and space for their own evil ends.
* Threat Level to Melkor: Medium. TimeStandsStill is a broken ability but the fact that [[DangerousForbiddenTechnique she must die shortly after using it]] sort of mitigates that.
* Lesser Goddess
* Symbol: The Time Staff
* Alignment: LawfulGood
* Allies: The Sailor Senshi
* Reasong for joining: To ensure that nobody abuses the Gates of Time. And she'd like to make herself known after [[PlutoIsExpendable Pluto is no longer considered a planet]].
* Loyalty to Cosmos: High. Cosmos opposes those who would abuse time and space for their own evil ends.
* Threat Level to Melkor: Medium. TimeStandsStill is a broken ability but the fact that [[DangerousForbiddenTechnique she must die shortly after using it]] sort of mitigates that.
Deleted line(s) 2467,2474 (click to see context) :
'''Commander the {{Non Entity General}}'''
* Demi-Greater God/Goddess
* Symbol: Variable, symbol changes daily to that of (temporarily) aligned faction
* Alignment: Variable, alignment changes regularly to that of (temporarily) aligned faction
* Reason for Joining: Receives missions from Cosmos by way of Full Motion Video Cutscenes.
* Loyalty to Cosmos: The duration of each mission; nothing more, nothing less. Commander is also commanding opposing forces of Pantheon/{{Grand United Alliance of Evil}} in addition to Pantheon/CouncilOfShadows, Pantheon/CouncilOfCloudcuckooland, and even Mary Suetopia.
* Threat Level to Melkor: Variable, Low-Extreme. In circumstances of NoCampaignForTheWicked GUAE have little chance of victory.
Is there an issue? Send a MessageReason:
None
Changed line(s) 415 (click to see context) from:
* Allies: [[{{Main/Mother3}} Lucas]], [[Main/AvatarTheLastAirbender Aang]].
to:
* Allies: [[{{Main/Mother3}} [[{{Mother 3}} Lucas]], [[Main/AvatarTheLastAirbender Aang]].
Changed line(s) 418,419 (click to see context) from:
* Threat Level to Melkor:
to:
* Threat Level to Melkor:
Melkor: Moderate. While just a kid, has powerful PSI abilities and never leaves home without a baseball bat.
Is there an issue? Send a MessageReason:
An estimate. Counting the Link from the Four Swords games four times, and not including the unreleased Skyward Sword.
Changed line(s) 377,378 (click to see context) from:
'''[[Main/TheLegendOfZelda Link]], God of Diversified Weaponry''' (The Hero of Time)
* Lesser God
* Lesser God
to:
* Lesser
Changed line(s) 381 (click to see context) from:
* Reason for joining: [[BecauseDestinySaysSo Because destiny said so]].
to:
* Reason for joining: [[BecauseDestinySaysSo Because destiny said so]]. [[LegacyCharacter For all]] [[strike:[[LegacyCharacter eight]]]] [[MesACrowd eleven]] [[LegacyCharacter of them.]]
** Like the Doctor, multiple incarnations of Link are part of this army.
** Like the Doctor, multiple incarnations of Link are part of this army.
Is there an issue? Send a MessageReason:
None
Changed line(s) 326 (click to see context) from:
'''Main/PacMan, God of [[Main/BigEater Gluttony]]'''
to:
Is there an issue? Send a MessageReason:
Was that necessary?
Changed line(s) 294 (click to see context) from:
'''CourageTheCowardlyDog, God of [[CowerPower Cowardice]]''' (Stupid Dog!)
to:
'''CourageTheCowardlyDog, God of [[CowerPower Cowardice]]''' (Stupid Dog!)Dog!, You Twit!)
Changed line(s) 299 (click to see context) from:
* Loyalty to Cosmos: Cosmos occasionally comes to him in the form of Muriel Bagge when Courage is lonely or scared. So obviously he's pretty loyal to her, [[CatchPhrase or his name is]] [[hottip:*:[[ThatGuyWithTheGlasses Tackanovahumpashirerickydickyhamstermasterpollywollywannabingbangsupercalifragilisticnickknackpaddywhackgiveadogabananafannafofrescahickorydickoryhocketypocketywocketyangelinafrancescathethird.]]]] [[CatchPhrase ... And thank goodness it isn't.]]
to:
* Loyalty to Cosmos: Cosmos occasionally comes to him in the form of Muriel Bagge when Courage is lonely or scared. So obviously he's pretty loyal to her, [[CatchPhrase or his name is]] [[hottip:*:[[ThatGuyWithTheGlasses Tackanovahumpashirerickydickyhamstermasterpollywollywannabingbangsupercalifragilisticnickknackpaddywhackgiveadogabananafannafofrescahickorydickoryhocketypocketywocketyangelinafrancescathethird.]]]] [[CatchPhrase ... And thank goodness it isn't.]] One Eyed [=McJoe=]. ''And it's not!''
Deleted line(s) 302 (click to see context) :
Is there an issue? Send a MessageReason:
I feel such a dick for doing this.
Changed line(s) 284,285 (click to see context) from:
* Threat Level to Melkor:
to:
* Threat Level to Melkor:
Melkor: Moderate-to-high, due to being made of rubber. Melkor is still examining how that happened.
Is there an issue? Send a MessageReason:
Umm...
Changed line(s) 242 (click to see context) from:
** Extra reasoning: To defeat the GUAE's Cypha of Huckebein, not only for horribly wounding Signum the same way Juergen 'beat' her, reliving her of the bad memories, Lamia thinks her actions defiled the sacred name of 'Huckebein' which has been praised as one of the SuperRobots that defended the force of good, thus she's out to make Cypha pay.
to:
** Extra reasoning: To defeat the GUAE's Cypha of Huckebein, not only for horribly wounding Signum the same way Juergen 'beat' her, reliving her of the bad memories, Lamia thinks her actions defiled the sacred name of 'Huckebein' which has been praised as one of the SuperRobots {{Super Robot}}s that defended the force of good, thus she's out to make Cypha pay.
Changed line(s) 244,245 (click to see context) from:
* Threat level to Melkor: Low. Used to be Moderate, but once Melkor learned about the incident with Juergen, he immediately puts Lamia into 'Those hit with BadassDecay[=/=]{{Chickification}} List' and thinks she'll never restore her status. Time will tell if Lamia could reverse that.
to:
* Threat level to Melkor: Low. Used to be Moderate, but once Melkor learned about the incident with Juergen, he immediately puts Lamia into 'Those hit with BadassDecay[=/=]{{Chickification}} List' and thinks she'll never restore her status. Time will tell if Lamia could reverse that.
Low.
Is there an issue? Send a MessageReason:
So is it low, or not?!
Changed line(s) 137,138 (click to see context) from:
* Threat level to Melkor: Low. Melkor just sees him as the SpoonyBard. [[spoiler:He has yet to learn about Edward's taking level in badass]]
to:
* Threat level to Melkor: Low. Melkor just sees him as the SpoonyBard. [[spoiler:He has yet to learn about Edward's taking level in badass]]
???
Is there an issue? Send a MessageReason:
None
Changed line(s) 359 (click to see context) from:
'''[[Main/DoctorWho The Doctor]], God (and Lord) of Time''' (Theta Sigma, The Last of The Time Lords, The Oncoming Storm, Ka-Faraq-Gatri, Destroyer of Worlds, Bane of Nightmares, John Smith, The Lonely God, The Man Who Gives Monsters Nightmares, The Raggedy Doctor)
to:
'''[[Main/DoctorWho The Doctor]], God (and Lord) of Time''' (Theta Sigma, The Last of The Time Lords, The Oncoming Storm, Ka-Faraq-Gatri, Destroyer of Worlds, Bane of Nightmares, John Smith, The Lonely God, The Man Who Gives Monsters Nightmares, The Raggedy Doctor)Doctor, Sweetie, The Martian, Dr. James [=McCrimmon=] of the University of Balamory)
Changed line(s) 362 (click to see context) from:
* Alignment: Varies (Usually CG, NG, or LG, sometimes CN)
to:
* Alignment: Varies (Usually CG, NG, ChaoticGood, NeutralGood, or LG, LawfulGood, sometimes CN)ChaoticNeutral)
Changed line(s) 366,367 (click to see context) from:
* Threat Level to Melkor: EXTREME. To quote the doctor himself: '' I'm the Doctor and you're in the biggest Library in the universe. [pauses] '''Look me up.''' ''
to:
* Threat Level to Melkor: EXTREME. To quote the doctor himself: '' I'm the Doctor and you're in the biggest Library in the universe. [pauses] '''Look me up.''' ''
Is there an issue? Send a MessageReason:
None
Changed line(s) 59 (click to see context) from:
'''[[{{Godzilla}}, God of {{Kaiju}}''' (King of the Monsters, Gojira)
to:
Is there an issue? Send a MessageReason:
None
Changed line(s) 51 (click to see context) from:
'''[[Main/{{Pokemon}} Pikachu]], God of [[Main/{{Mon}} Wild Mythical Creatures]]'''
to:
Changed line(s) 56,59 (click to see context) from:
* Loyalty to Cosmos: As loyal as Ash is.
* Threat Level to Melkor: Moderate. That little yellow mouse's shocks can blow up damn near any mecha they hit.
'''[[{{Godzilla}} Godzilla]], God of {{Kaiju}}''' (King of the Monsters, Gojira)
* Threat Level to Melkor: Moderate. That little yellow mouse's shocks can blow up damn near any mecha they hit.
'''[[{{Godzilla}} Godzilla]], God of {{Kaiju}}''' (King of the Monsters, Gojira)
to:
* Loyalty to Cosmos: As loyal as Moderate; without Ash is.
possibly Low.
* Threat Level to Melkor: Moderate. That little yellow mouse's shocks can blow up damn near any mecha theyhit.
'''[[{{Godzilla}} Godzilla]],hit. And that's WITHOUT being supercharged or aided by a gang of other Pikachu.
'''[[{{Godzilla}}, God of {{Kaiju}}''' (King of the Monsters, Gojira)
* Threat Level to Melkor: Moderate. That little yellow mouse's shocks can blow up damn near any mecha they
'''[[{{Godzilla}} Godzilla]],
'''[[{{Godzilla}}, God of {{Kaiju}}''' (King of the Monsters, Gojira)
Is there an issue? Send a MessageReason:
Why was Virtuous placed here and not in the Medical Division?
Deleted line(s) 870,877 (click to see context) :
'''[[Main/SoulNomadAndTheWorldEaters Virtuous]], Goddess of Reverse Reapers''' (Master of Life, Layna the Firebrand, Layna the Venerable)
* Greater Goddess
* Symbol: Her staff
* Alignment: NeutralGood
* Reason for Joining: The GUAE would abuse the dead and the living alike for their own gain. The proper balance of the cycle of souls must be preserved...
* Loyalty to Cosmos: It's more of a partnership than anything else, but Virtuous has a lot of respect for Cosmos. It helps that their goals, methods, and ideals are quite similar.
* Threat level to Melkor: Significant. As long as Virtuous is alive, she can ensure that slain GUAE members reincarnate in weak vessels under the most inconvenient circumstances possible, and the reverse is true for the GUAG. Virtuous isn't the GUAG's strongest fighter, but Melkor has [[ShootTheMedicFirst made her destruction a top priority.]]
* Greater Goddess
* Symbol: Her staff
* Alignment: NeutralGood
* Reason for Joining: The GUAE would abuse the dead and the living alike for their own gain. The proper balance of the cycle of souls must be preserved...
* Loyalty to Cosmos: It's more of a partnership than anything else, but Virtuous has a lot of respect for Cosmos. It helps that their goals, methods, and ideals are quite similar.
* Threat level to Melkor: Significant. As long as Virtuous is alive, she can ensure that slain GUAE members reincarnate in weak vessels under the most inconvenient circumstances possible, and the reverse is true for the GUAG. Virtuous isn't the GUAG's strongest fighter, but Melkor has [[ShootTheMedicFirst made her destruction a top priority.]]
Is there an issue? Send a MessageReason:
The ROTK and Sengoku people are commanders.
Changed line(s) 1141 (click to see context) from:
'''[[SengokuBasara Tokugawa Ieyasu]], God of Patience''' (Matsudaira Takechiyo)
to:
Deleted line(s) 1143,1150 (click to see context) :
* Symbol: Crest of the Tokugawa clan.
* Alignment: Lawful Good
* Reason for Joining: To prove that The Power of Bonds is invincible and can unite to achieve the greater good. Also, he wants to show Nobunaga the errors of his way (which he couldn't show back then since he was a JamesBondage extraordinary beforehand) and his grand mission to use The Power of Bonds to rescue the people within GUAE's Token Good Members and break the barrier between actual good members and Token Bad Guy Members.
* Loyalty to Cosmos: Cosmos believed in the Power of Bonds and keeps the line when Ieyasu is starting to stray off, so Ieyasu considers him a good friend.
* Threat Level to Melkor: High. He's quite the capable warlord, and no longer the guy who keeps getting kidnapped all the time. Recently went between high and very high, after [[Pantheon/BookOfTrope his successful attempt to raid the GUAE's Token Good Guy Members' prison and rescued TWO Goddesses]], showing of his charisma.
'''[[Main/CaptainPlanetAndThePlaneteers Captain Planet]], God of Nature''' (Our Hero)
* Intermediate God
* Alignment: Lawful Good
* Reason for Joining: To prove that The Power of Bonds is invincible and can unite to achieve the greater good. Also, he wants to show Nobunaga the errors of his way (which he couldn't show back then since he was a JamesBondage extraordinary beforehand) and his grand mission to use The Power of Bonds to rescue the people within GUAE's Token Good Members and break the barrier between actual good members and Token Bad Guy Members.
* Loyalty to Cosmos: Cosmos believed in the Power of Bonds and keeps the line when Ieyasu is starting to stray off, so Ieyasu considers him a good friend.
* Threat Level to Melkor: High. He's quite the capable warlord, and no longer the guy who keeps getting kidnapped all the time. Recently went between high and very high, after [[Pantheon/BookOfTrope his successful attempt to raid the GUAE's Token Good Guy Members' prison and rescued TWO Goddesses]], showing of his charisma.
'''[[Main/CaptainPlanetAndThePlaneteers Captain Planet]], God of Nature''' (Our Hero)
* Intermediate God
Deleted line(s) 1412,1427 (click to see context) :
'''[[SengokuBasara Date Masamune]], God of [[EyepatchOfPower Eyepatches]]''' (One-Eyed Dragon, Dokuganryuu Date Masamune, Oushuu Hittou (Oushuu's First Man))
* Lesser God
* Symbol: [[NiceHat His crescent helmet]] and a ''tsuba used as an eyepatch'' with the background of the Date clan crest.
* Alignment: ChaoticGood
* Reason for joining: The GUAE kept interrupting his fated duel with Sanada Yukimura. He now joins the GUAG to make sure their duel goes uninterrupted, and when he learnt that his SamuraiWarriors self joined the GUAE because they beat him, he's more than eager to kick his ass to show him that to be called a 'Date Masamune', they should not ass-kiss out of whim. Lastly? Mitsunari just entered the GUAE... [[GratuitousEnglish VENGEANCE TIME]].
* Loyalty to Cosmos: Unlike his SamuraiWarriors self, Masamune does not bow to demons even if they whooped him hard. He assured Cosmos that she's got herself a powerful, yet loyal ally.
* Threat Level to Melkor: Moderate-high. A great warlord at that much young age is a credible threat and the fact that it's not easy for him to bow down like his SamuraiWarriors self makes it even harder for Melkor to deal with Masamune. Even when he's actually Curb Stomped by Mitsunari in the past, he's been making quick recovery to avoid being put in "Those hit with Badass Decay/Chickification list"
'''[[RomanceOfTheThreeKingdoms Guan Yu]], God of [[BadassBeard Beards]]''' (Lord Guan)
* Greater God
* Symbol: One Blue Dragon Saber stuck on the ground
* Alignment: LawfulGood
* Reason for joining: To make a good example of Godhood and atone for his blunders that caused him to fall in his mortal battle in Fancheng.
* Loyalty to Cosmos: High. Cosmos reminded him of his brother Liu Bei, only without those MoralDissonance.
* Threat level to Melkor: Low. He's in a similar note with Lamia, Mikagami and Spider-Woman; Melkor remembers his blunder in Fancheng and despite his influence, he'd still consider Guan Yu a failure thus easy to defeat.
* Lesser God
* Symbol: [[NiceHat His crescent helmet]] and a ''tsuba used as an eyepatch'' with the background of the Date clan crest.
* Alignment: ChaoticGood
* Reason for joining: The GUAE kept interrupting his fated duel with Sanada Yukimura. He now joins the GUAG to make sure their duel goes uninterrupted, and when he learnt that his SamuraiWarriors self joined the GUAE because they beat him, he's more than eager to kick his ass to show him that to be called a 'Date Masamune', they should not ass-kiss out of whim. Lastly? Mitsunari just entered the GUAE... [[GratuitousEnglish VENGEANCE TIME]].
* Loyalty to Cosmos: Unlike his SamuraiWarriors self, Masamune does not bow to demons even if they whooped him hard. He assured Cosmos that she's got herself a powerful, yet loyal ally.
* Threat Level to Melkor: Moderate-high. A great warlord at that much young age is a credible threat and the fact that it's not easy for him to bow down like his SamuraiWarriors self makes it even harder for Melkor to deal with Masamune. Even when he's actually Curb Stomped by Mitsunari in the past, he's been making quick recovery to avoid being put in "Those hit with Badass Decay/Chickification list"
'''[[RomanceOfTheThreeKingdoms Guan Yu]], God of [[BadassBeard Beards]]''' (Lord Guan)
* Greater God
* Symbol: One Blue Dragon Saber stuck on the ground
* Alignment: LawfulGood
* Reason for joining: To make a good example of Godhood and atone for his blunders that caused him to fall in his mortal battle in Fancheng.
* Loyalty to Cosmos: High. Cosmos reminded him of his brother Liu Bei, only without those MoralDissonance.
* Threat level to Melkor: Low. He's in a similar note with Lamia, Mikagami and Spider-Woman; Melkor remembers his blunder in Fancheng and despite his influence, he'd still consider Guan Yu a failure thus easy to defeat.
Is there an issue? Send a MessageReason:
None
Changed line(s) 2023,2024 (click to see context) from:
* Threat level to Melkor: Low. JokeCharacter...
to:
* Threat level to Melkor: Low. JokeCharacter...
JokeCharacter...[[LethalJokeCharacter right?]]
Is there an issue? Send a MessageReason:
None
Changed line(s) 193 (click to see context) from:
* Reason for Joining: Having defeated his longtime nemesis, Sonic is free to concentrate on fighting Eggman, who along with [[MegaMan Wily]] is making robots for the GUAE.
to:
* Reason for Joining: Having defeated his longtime nemesis, [[PolygonCeiling nemesis]], Sonic is free to concentrate on fighting Eggman, who along with [[MegaMan Wily]] is making robots for the GUAE.
Is there an issue? Send a MessageReason:
None
Added DiffLines:
'''SonicTheHedgehog, Slayer of the PolygonCeiling''' (Blue Blur, Nineties Video Game Legend)
* Intermediate God
* Symbol: Red Shoes; His Head
* Alignment: Chaotic Good
* Reason for Joining: Having defeated his longtime nemesis, Sonic is free to concentrate on fighting Eggman, who along with [[MegaMan Wily]] is making robots for the GUAE.
* Loyalty to Cosmos: As long as she stands for freedom and good, Sonic won't let her down.
* Threat Level to Melkor: Low to medium, unless he finds all the [[MineralMacGuffin Chaos Emeralds]], then high.
* Intermediate God
* Symbol: Red Shoes; His Head
* Alignment: Chaotic Good
* Reason for Joining: Having defeated his longtime nemesis, Sonic is free to concentrate on fighting Eggman, who along with [[MegaMan Wily]] is making robots for the GUAE.
* Loyalty to Cosmos: As long as she stands for freedom and good, Sonic won't let her down.
* Threat Level to Melkor: Low to medium, unless he finds all the [[MineralMacGuffin Chaos Emeralds]], then high.
Is there an issue? Send a MessageReason:
None
Added DiffLines:
'''Commander the {{Non Entity General}}'''
* Demi-Greater God/Goddess
* Symbol: Variable, symbol changes daily to that of (temporarily) aligned faction
* Alignment: Variable, alignment changes regularly to that of (temporarily) aligned faction
* Reason for Joining: Receives missions from Cosmos by way of Full Motion Video Cutscenes.
* Loyalty to Cosmos: The duration of each mission; nothing more, nothing less. Commander is also commanding opposing forces of Pantheon/{{Grand United Alliance of Evil}} in addition to Pantheon/CouncilOfShadows, Pantheon/CouncilOfCloudcuckooland, and even Mary Suetopia.
* Threat Level to Melkor: Variable, Low-Extreme. In circumstances of NoCampaignForTheWicked GUAE have little chance of victory.
Is there an issue? Send a MessageReason:
None
Added DiffLines:
'''[[BlazBlue Noel Vermillion]], Goddess of [[{{Pettanko}} Small Breasts]]''' (Mu-12, Lacking Lady)
* Lesser Goddess
* Symbol: Her guns Bolverk crossed.
* Alignment: NeutralGood
* Reason for joining: After being freed/separated from her SuperpoweredEvilSide, she has started to oppose NOL and the GUAE overall. She hoped that she won't get into trouble anymore after this, [[ArsonMurderAndJaywalking and getting a bigger breasts]]. Also, she has to rescue Tsubaki who's still manipulated with NOL.
* Loyalty to Cosmos: Cosmos has done a lot of impossibles other than getting Ragna to free her; including making Jin at least sane in front of her, and rescuing Litchi so Noel can cuddle with her panda again. Not to mention, she stands for what she thinks is good. So loyalty confirmed.
* Threat Level to Melkor: Now that she's not with her SuperpoweredEvilSide? Medium-Low for Melkor. She's a needy, whiny brat, he thinks. Still, her Bolverk are not to be underestimated
* Lesser Goddess
* Symbol: Her guns Bolverk crossed.
* Alignment: NeutralGood
* Reason for joining: After being freed/separated from her SuperpoweredEvilSide, she has started to oppose NOL and the GUAE overall. She hoped that she won't get into trouble anymore after this, [[ArsonMurderAndJaywalking and getting a bigger breasts]]. Also, she has to rescue Tsubaki who's still manipulated with NOL.
* Loyalty to Cosmos: Cosmos has done a lot of impossibles other than getting Ragna to free her; including making Jin at least sane in front of her, and rescuing Litchi so Noel can cuddle with her panda again. Not to mention, she stands for what she thinks is good. So loyalty confirmed.
* Threat Level to Melkor: Now that she's not with her SuperpoweredEvilSide? Medium-Low for Melkor. She's a needy, whiny brat, he thinks. Still, her Bolverk are not to be underestimated
Is there an issue? Send a MessageReason:
None
Changed line(s) 1726 (click to see context) from:
to:
'''[[SengokuBasara Honda Tadakatsu]], God of [[AnachronismStew Anachronistic Appearances]]''' (Sengoku's Strongest, Hondam)
* Lesser God
* Symbol: Himself, in chibi.
* Alignment: LawfulNeutral (though in the handles of Ieyasu, he's LawfulGood)
* Reason for Joining: He is loyal to Ieyasu, so wherever Ieyasu goes, he follows.
* Loyalty to Cosmos: [[TheUnintelligible !!!?!?!??!]]
-->'''Ieyasu''': ''Uh, he says that he likes Cosmos for being so understanding even for him. So yeah, he's loyal to me and her.''
* Threat Level to Melkor: High. Very great combat output, is practically indestructible and has loyalty so great that he cannot be affected with trolling...
* Lesser God
* Symbol: Himself, in chibi.
* Alignment: LawfulNeutral (though in the handles of Ieyasu, he's LawfulGood)
* Reason for Joining: He is loyal to Ieyasu, so wherever Ieyasu goes, he follows.
* Loyalty to Cosmos: [[TheUnintelligible !!!?!?!??!]]
-->'''Ieyasu''': ''Uh, he says that he likes Cosmos for being so understanding even for him. So yeah, he's loyal to me and her.''
* Threat Level to Melkor: High. Very great combat output, is practically indestructible and has loyalty so great that he cannot be affected with trolling...
Is there an issue? Send a MessageReason:
None
Added DiffLines:
'''[[SengokuBasara Date Masamune]], God of [[EyepatchOfPower Eyepatches]]''' (One-Eyed Dragon, Dokuganryuu Date Masamune, Oushuu Hittou (Oushuu's First Man))
* Lesser God
* Symbol: [[NiceHat His crescent helmet]] and a ''tsuba used as an eyepatch'' with the background of the Date clan crest.
* Alignment: ChaoticGood
* Reason for joining: The GUAE kept interrupting his fated duel with Sanada Yukimura. He now joins the GUAG to make sure their duel goes uninterrupted, and when he learnt that his SamuraiWarriors self joined the GUAE because they beat him, he's more than eager to kick his ass to show him that to be called a 'Date Masamune', they should not ass-kiss out of whim. Lastly? Mitsunari just entered the GUAE... [[GratuitousEnglish VENGEANCE TIME]].
* Loyalty to Cosmos: Unlike his SamuraiWarriors self, Masamune does not bow to demons even if they whooped him hard. He assured Cosmos that she's got herself a powerful, yet loyal ally.
* Threat Level to Melkor: Moderate-high. A great warlord at that much young age is a credible threat and the fact that it's not easy for him to bow down like his SamuraiWarriors self makes it even harder for Melkor to deal with Masamune. Even when he's actually Curb Stomped by Mitsunari in the past, he's been making quick recovery to avoid being put in "Those hit with Badass Decay/Chickification list"
'''[[RomanceOfTheThreeKingdoms Guan Yu]], God of [[BadassBeard Beards]]''' (Lord Guan)
* Greater God
* Symbol: One Blue Dragon Saber stuck on the ground
* Alignment: LawfulGood
* Reason for joining: To make a good example of Godhood and atone for his blunders that caused him to fall in his mortal battle in Fancheng.
* Loyalty to Cosmos: High. Cosmos reminded him of his brother Liu Bei, only without those MoralDissonance.
* Threat level to Melkor: Low. He's in a similar note with Lamia, Mikagami and Spider-Woman; Melkor remembers his blunder in Fancheng and despite his influence, he'd still consider Guan Yu a failure thus easy to defeat.
* Lesser God
* Symbol: [[NiceHat His crescent helmet]] and a ''tsuba used as an eyepatch'' with the background of the Date clan crest.
* Alignment: ChaoticGood
* Reason for joining: The GUAE kept interrupting his fated duel with Sanada Yukimura. He now joins the GUAG to make sure their duel goes uninterrupted, and when he learnt that his SamuraiWarriors self joined the GUAE because they beat him, he's more than eager to kick his ass to show him that to be called a 'Date Masamune', they should not ass-kiss out of whim. Lastly? Mitsunari just entered the GUAE... [[GratuitousEnglish VENGEANCE TIME]].
* Loyalty to Cosmos: Unlike his SamuraiWarriors self, Masamune does not bow to demons even if they whooped him hard. He assured Cosmos that she's got herself a powerful, yet loyal ally.
* Threat Level to Melkor: Moderate-high. A great warlord at that much young age is a credible threat and the fact that it's not easy for him to bow down like his SamuraiWarriors self makes it even harder for Melkor to deal with Masamune. Even when he's actually Curb Stomped by Mitsunari in the past, he's been making quick recovery to avoid being put in "Those hit with Badass Decay/Chickification list"
'''[[RomanceOfTheThreeKingdoms Guan Yu]], God of [[BadassBeard Beards]]''' (Lord Guan)
* Greater God
* Symbol: One Blue Dragon Saber stuck on the ground
* Alignment: LawfulGood
* Reason for joining: To make a good example of Godhood and atone for his blunders that caused him to fall in his mortal battle in Fancheng.
* Loyalty to Cosmos: High. Cosmos reminded him of his brother Liu Bei, only without those MoralDissonance.
* Threat level to Melkor: Low. He's in a similar note with Lamia, Mikagami and Spider-Woman; Melkor remembers his blunder in Fancheng and despite his influence, he'd still consider Guan Yu a failure thus easy to defeat.
Is there an issue? Send a MessageReason:
None
These are those good and noble gods who fight evil actively and martially. It is they who bear the brunt of the effort of the war against the Grand Unified Alliance Of Evil.
Changed line(s) 1402 (click to see context) from:
to:
'''[[{{Castlevania}} Shanoa]], Goddess of SexyBack'''
* Lesser Goddess
* Symbol: The Glyph symbol
* Alignment: NeutralGood
* Reason for joining: Invited by Simon Belmont and Adrian Fahrenheight Tepes to destroy Dracula.
* Loyalty to Cosmos: Cosmos also noticed her heroism and is willing to make her name not disappear from history, while making sure the power of the Glyphs are not misused, earning Shanoa's trust.
* Threat level to Melkor: Low. Melkor knows what she could do thanks to Dracula, and when compared to the Belmonts, she's seen to be kind of lacking.
'''[[SuperRobotWars Selena Recital]], Goddess of [[{{Gainaxing}} Bouncing]] [[JigglePhysics Breasts]]'''
* Lesser Goddess
* Symbol: [[strike:Chibi Alegrias]] Her breasts, ever in motion. ([[http://img467.imageshack.us/img467/4840/akibakko11601860049024sh5.gif seen here]])
* Alignment: True Neutral
* Reason for joining: To arouse the good guys with her {{Fanservice}}. Also, she opposes Keisar Ephes and the SRW villians in the GUAE, and is joining to make them pay for one of their agents murdering her squadmates awhile back.
* Loyalty to Cosmos: Even if she [[HeelFaceRevolvingDoor looks as if she switches allegiance too much]], she is still loyal to Cosmos and will eventually return to her.
* Threat Level to Melkor:
'''[[Main/SaintSeiya Virgo Shaka]], God of [[Main/EyesAlwaysShut Constantly-Slitted Eyes]]''' (Virgo Saint, Buddha incarnate)
* Greater God
* Symbol: Virgo Golden Cloth
* Alignment: LawfulGood
* Reason for joining: It's his duty as a Gold Saint to defend the good.
* Loyalty to Cosmos:
* Threat Level to Melkor: Very High to Extreeme if he opens his eyes. If not, High. But Melkor pisses him off, so the very high estiamte might be more accurate.
'''[[RaidouKuzunohaVsTheSoullessArmy Raidou Kuzunoha the 14th]], God of [[NiceHat Hats]]'''
* Lesser God
* Symbol: His hat (obviously)
* Alignment: LawfulGood
* Reason for Joining: A GUAE member shot at his hat (they missed, but ''still''...)
* Loyalty to Cosmos: She likes the hat and doing the right thing. Loyalty confirmed.
* Threat Level to Melkor:
'''[[BlazBlue Bang Shishigami]], God of HighlyVisibleNinja'''
* Lesser God
* Symbol: The Ikaruga crest, with his nail nearby.
* Alignment: LawfulGood
* Reason for joining: To uphold love, and justice, and eventually use his fame and prowess to eventually rebuild Ikaruga! [[Pantheon/BookOfTrope As well as protecting Miss Litchi from any bad guidances after she has been rescued]].
* Loyalty to Cosmos: Very high. Cosmos could turn Jin Kisaragi that he hated into a genuine force of good, and upholds justice well.
* Threat level to Melkor: Pending. He's always seen as a joke by Melkor, but it has been discovered that he's training to use a Nox Nyctores. Threat level waiting until Melkor can gauge what the Nox can do.
'''[[GGundam Schwarz Bruder]], God of [[McNinja Non-Japanese Ninja]]''' ([[spoiler:Kyoji Kasshu]])
* Lesser God
* Symbol: His German Mask, next to the head of Spiegel Gundam
* Alignment: TrueNeutral
* Reason for joining: Claims to be watching over and helping Domon, but he might have some ulterior motives. Whatever it is, it's not of nasty thoughts.
* Loyalty to Cosmos: Cosmos restored him, his Gundam, AND his ninja skills. He's good with her.
* Threat Level to Melkor:
'''[[Main/{{Narnia}} Aslan]], God of [[Main/CrystalDragonJesus Religious Metaphors]]''' (King Of Beasts, The Lion, The Lamb)
* Greater God
* Symbol: A White Lamb...no, wait, a Lion...no wait, a lamb!
* Alignment: Lawful Good
* Reason for Joining: It was foretold at the beginning of all things.
* Loyalty to Cosmos: Very strong.
* Threat Level to Melkor: High.
'''[[Main/WonderWoman Diana of Themiscyra]], Goddess of Truth''' (Wonder Woman)
* Intermediate Goddess
* Symbol: Double letter W, or golden eagle
* Alignment: LawfulGood
* Reason for Joining: To defend those that cannot defend themselves.
* Loyalty to Cosmos: Hold Cosmos in high regard as a strong woman committed to justice. Loyalty high.
* Threat Level to Melkor: High.
'''[[{{Main/ShinMegamiTenseiNocturne}} Naoki Kashima]], Fulcrum of Order and Chaos''' (Demi-Fiend, Hitoshura)
* Demi...Fiend
* Symbol: A demonic magatama
* Alignment: TrueNeutral, edging towards NeutralGood
* Reason for Joining: He's supposed to be a neutral force, but Cosmos' side eventually won out.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''Main/LeeroyJenkins, The Destroyer Of Philosophies'''
* Intermediate God
* Symbol: A mountain of fried chickens
* Alignment: [[LawfulStupidChaoticStupid Chaotic Stupid]]
* Reason for joining: No reason. He's just there to jump off into the fray of battle, kick ass while yelling "'''LEEROOOOYYYY!!! JEEEENKIIINNNSS!!!'''"
* Loyalty to Cosmos: No loyalty. He's just on Cosmos' side because he's a Paladin, and Paladins aren't supposed to be with evil.
* Threat level to Melkor: Moderate. Supposedly low, since he's a liability to the good guys. But there are times when Leeroy goes over the top in his charge and actually becomes an OneManArmy, so... Melkor reconsiders.
'''[[StreetFighter Ryu]], God of [[ToBeAMaster Those Who Wants To Be The Best]]'''
* Intermediate God
* Symbol: HADOKEN!
* Alignment: TrueNeutral
* Reason for joining: To have a chance to fight many powerful evil Gods.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Vivio Takamachi]], Goddess of [[Main/CloneJesus Cloned Messiahs]]''' (The Saint King, The Sankt Kaiser, Sankt Regina Olivie)
* Intermediate Goddess
* Symbol: The head of Sacred Heart, her bunny plushie Device.
* Alignment: NeutralGood
* Reason for joining: Accompanying Nanoha-mama and Fate-mama.
* Loyalty to Cosmos: Cosmos is nice to her mamas ''and'' to her, so Vivio likes her.
* Threat Level to Melkor: Moderate. She's seen to have taken levels in badass. And Melkor knew what happened to the poor bitch who tried kidnapping her and triggering the wrath of Nanoha...
'''[[GunXSword Van]], God of [[IHaveManyNames Men With Multiple Names]] and Patron Protector of Weddings''' (Van the Devil Swallowtail Suit, Van of the Dawn (his favorite), Van That Weird Guy Who Helped Out, [[GratuitousEnglish Van Za Naisu Gai]], Pretty Van From The Garbage Dump... gah, too many to list)
* Lesser God
* Symbol: [[HumongousMecha Dann of Thursday]]
* Alignment: TrueNeutral (with some ChaoticGood tendencies)
* Reason for joining: Protecting the sacredness of wedding that the GUAE is threatening. That, and the GUAE has many people like The Claw, better kill'em before they hurt anyone else.
* Loyalty to Cosmos: Cosmos reminded him of Elena and showed him a way to fight without relying on revenge, thus Van is grateful.
* Threat Level to Melkor: High, Melkor's aware of what this guy has accomplished with ThePowerOfLove powering his RoaringRampageOfRevenge.
'''[[Main/{{Watchmen}} Doctor Manhattan]], God of [[Main/{{YouCantFightFate}} Fatalism]]''' (Jon Osterman)
* Intermediate God
* Symbol: A hydrogen atom
* Alignment: TrueNeutral (can tend towards NeutralGood)
* Reason for Joining: To protect the innocent, and because as far as he is concerned, he already joined next week years ago.
* Loyalty to Cosmos: He finds her resolve and empathy endearing, if not inspiring.
* Threat Level to Melkor: High. Manhattan may not believe he can fight fate, but when he bothers trying, things '''explode.'''
'''[[Main/GauntsGhosts Saint]] [[{{Warhammer 40000}} Sabbat]], God of [[Main/BecauseDestinySaysSo Predetermined Fate]]''' (The Saint, The Beati)
* Intermediate Goddess
* Symbol: The flower Islumbine
* Alignment: ChaoticGood
* Reason for Joining: Aids Cosmos' mission against the GUAE, which is tied to her her goal of opposing Chaos.
* Loyalty to Cosmos: Cosmos is in direct opposition to Chaos, whose gods are high ranking commanders in the GUAE. Loyalty is thus quite high.
* Threat Level to Melkor:
'''[[Main/{{Persona3}} Mitsuru Kirijo]], Goddess of FateWorseThanDeath''' (Mitsuru-senpai)
* Lesser Goddess
* Symbol: The Kirijo group badge
* Alignment: LawfulGood
* Reason for joining: To uphold the honor of the Kirijo family.
* Loyalty to Cosmos: Betrayal would mean repeating the same disgraces that the family committed in the past, so she's really loyal to her.
* Threat Level to Melkor:
'''[[Main/RanmaOneHalf Ranma Saotome]], God ''and'' Goddess of [[Main/GenderBender Gender Bending]]''' (Aquatranssexual, Ranko)
* Male/Female Quasideity
* Symbol: A bucket and kettle
* Alignment: ChaoticNeutral
* Reason for Joining: He ordinarily wouldn't care, but considering the GUAE hired Shinji Matou to go around raping women in the GUAG, even he was horrified, especially when that ''bastard tried to have a go at him!'' That said, he joining the good guys to hunt him down and kick his ass!
* Loyalty to Cosmos: Moderate-High, believe or not. The fact she hasn't given him grief over his curse or tried to become another member of his UnwantedHarem was several points in her favor.
* Threat Level to Melkor: High enough that Melkor keeps a RightHandCat and a bucket of cold water nearby at all times.
'''[[Main/{{Discworld}} Angua von Uberwald]], Goddess of [[Main/OurWerewolvesAreDifferent Werecreatures]]''' (Sergeant Angua)
* Lesser Deity
* Symbol: A badge of the Ankh-Morpork City Watch, on a dog-collar
* Alignment: LawfulGood
* Reason for Joining: Well, her boss and boyfriend are already opposing evil, and besides, the GUAE has many who discriminate against those like herself and she wants to keep them from harming her followers.
* Loyalty to Cosmos: Following her boss and boyfriend's lead, and is sympathetic to Cosmos' ideals of peace.
* Threat Level to Melkor:
'''[[{{Hellsing}} Alucard]], God of [[HealingFactor Regeneration]] and Hell Hounds'''
* Greater God
* Symbol: Demonic grin, tongue hanging out
* Alignment: LawfulEvil
* Reason for Joining: Orders from Sir Integra, and a chance to cut loose!
* Loyalty to Cosmos: Has some respect for her but his loyalty is to Integra.
* Threat Level to Melkor: High. He is Vlad the Impaler and downright crazy. Melkor does hope he can get him to switch sides.
'''[[StreetFighter Edmond Honda]], God of Sumo'''
* Lesser God
* Symbol: His face-marking.
* Alignment: ChaoticNeutral
* Reason for Joining: Promoting Sumo. Oh, and having lots of good fights too.
* Loyalty to Cosmos: Cosmos likes sumo. Honda is always good with those who likes sumo.
* Threat Level to Melkor:
'''[[{{Transformers}} Optimus Prime]], God of Mecha''' (Peterbilt, Peter Cullen, [[TransformersGeneration1 TRUKK]], Optronix, Orion Pax)
* Lesser God... apparently. He goes toe-to-toe with some Greater Gods without coming off second best.
* Symbol: The Autobot emblem
* Alignment: LawfulGood
* Reason for Joining: Because freedom is the right of all sentient beings, and the GUAE would take away that freedom.
* Loyalty to Cosmos: High
* Threat Level to Melkor: Fairly High; Melkor remembers what happened to Megatron, Starscream, Grindor, and The Fallen last time Optimus cut loose.
'''[[FullmetalAlchemist Alphonse Elric]], God of Machines''' (The Living Armor)
* Intermediate God
* Symbol: A metallic arm, the helmet that is his head
* Alignment: NeutralGood
* Reason for Joining: He was promised to gain back his body and be reunited with his family.
* Loyalty to Cosmos:
* Threat Level to Melkor: Low, unless Ed shows up, in which case it can be upgraded to Medium.
'''[[FantasticFour Reed Richards]], God of Comic Book Science.'''
* Intermediate God
* Symbol: A circle with a four in it.
* Alignment: NeutralGood
* Reason for Joining: Its the right thing to do, and like Tony he feels the need to make up for his actions during the Civil War.
* Loyalty to Cosmos:
* Threat Level to Melkor: Moderate-low, hem may have superpowers, range, and high resistance to bludgeons, but, after all, ReedRichardsIsUseless.
'''[[Main/SuperRobotWars Ryusei Date]], God of [[Main/AscendedFanboy Ascended Fanboys]]'''
* Lesser God
* Symbol: Chibi R-1.
* Alignment: LawfulGood
* Reason for joining: Because it's right. It also gives him the chance to fulfill his greatest dream of being a good ol' SuperRobot hero fighting against ultimate evil.
* Loyalty to Cosmos: He's a good guy, she Good incarnate. He's totally loyal.
* Threat level to Melkor: Moderate-High. His Psychodriver power is not to be underestimated.
'''[[CaptainN Kevin Keene]] and [[CaptainSNES Alex Williams]], Dueling Gods of [[MassiveMultiplayerCrossover Video Game Crossovers]]''' (Captain N, Captain SNES)
* Quasideity (Kevin), Demigod (Alex)
* Symbols: A Zapper light gun and an NES controller (Kevin), a Super Scope (Alex)
* Alignment: NeutralGood (Kevin), ChaoticGood (Alex)
* Reason for joining: For Kevin, he wants to have a chance to [[PacManFever have a correct grasp on videogame character images]]. For Alex, he claims to be doing it as part of a deal to get his pants back, but many suspect he simply desires to have a chance to be a hero without being someone's UnwittingPawn for once.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/SamuelLJackson Samuel L. Jackson]], God of [[Main/SoulBrotha BMFs]]''' ([[PulpFiction Jules Winnfield]], [[DieHard Zeus Carver]], [[StarWars Mace Windu]], [[SnakesOnAPlane Agent Neville Flynn]], [[MarvelUniverse Nick Fury]], and many more.)
* Intermediate God
* Symbol: A wallet that says Bad Motherfucker
* Alignment: ChaoticNeutral
* Reasong for joining: "Enough is enough! I have HAD it with these MOTHERFUCKING evils on this MOTHERFUCKING Pantheon!!"
* Loyalty to Cosmos: Hey, God saved his life once, motherfucker. Cosmos might as well be an aspect of that, so he's told her he was helping out to show the GUAE why he's a "bad motherfucker".
* Threat Level to Melkor: High. Do you not understand the term [[ExactlyWhatItSaysOnTheTin "Bad Motherfucker?"]]
'''[[Main/MahouSenseiNegima Evangeline A.K. [=McDowell=]]], Goddess of [[Main/ElegantGothicLolita Goth Loli]]''' (Eva, Student #26, The Doll Master, The Dark Evangel, The Undying Mage, Apostle of Destruction, Demon king in the form of a child, The advent of evil, Demon lord of darkness, [[strike: Kitty]])
* Intermediate Goddess
* Symbol: The moon
* Alignment: ChaoticNeutral
* Reason for Joining: Because deep down she knows it's the right thing to do; she will, however, VIOLENTLY deny this if asked, stating she's "looking for more dark disciples".
* Loyalty to Cosmos: Little. according to her, she's just helping for the above reason. However, Cosmos has privately told others Evangeline's a better person than she appears, and she's not worried about anything.
* Threat Level to Melkor: Fairly High. Evangeline may be nowhere near as evil/vicious as her reputation states, but she's just as powerful.
'''[[Main/SaturdayNightLive Bill Brasky]], God of [[Main/MemeticBadass Legendary Deeds]]''' (The Divine Son of a Bitch)
* Greater God
* Symbol: A barracuda eating Neil Armstrong
* Alignment: TrueNeutral
* Reason for Joining: Remember that time when blood shot out of Melkor's nose for the first time in, like, ever? Yeah, Bill Brasky did that. A toast! To Bill Brasky!
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''Main/{{Deadpool}}, Destroyer of the Main/FourthWall''' (Merc With a Mouth, Wade Wilson)
* Intermediate God
* Symbol: a yellow narrative box
* Alignment: ChaoticNeutral
* Reason for Joining: The GUAE are no fun!
* Loyalty to Cosmos:
* Threat Level to Melkor: VERY High, due to his [[Main/GenreSavvy Genre Savviness]] and blatant ignorance of the [[Main/FourthWallObserver fourth wall]] allowing him to know just about everything there is to know about Melkor, including some more embarrassing details.
** When really pissed off, Deadpool becomes EXTREME threat because of one thing: He'd break the ultimate Fourth Wall, tell all tropers to delete Melkor and all of his existence from TVTropes and destroy the GUAE in instant (with his gun pointed at the tropers' head to seal the deal). AndThatsTerrible.
'''[[Main/TheAdventuresOfDoctorMcNinja Dr. McNinja]], God of Main/CrazyAwesome'''
* Intermediate God
* Symbol: The mask and the white coat
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor: High. The whole McNinja clan is utterly unpredicatable and dangerous.
'''[[MontyPythonAndTheHolyGrail Sir Robin]], God of [[LovableCoward Charming Cowardice]]''' (Brave Sir Robin, The Not-Quite-So-Brave-As-Sir Lancelot)
* Quasideity
* Symbol: Black chicken
* Alignment: LawfulGood
* Reason for joining: He doesn't know. He just want to stay out of danger, but [[strike:Arthur]] Arturia commands him, so he had to obey.
* Loyalty to Cosmos:
* Threat level to Melkor: Low. He's only good at this command... '''"RUN AWAAAAAAYYYYY!!!!"'''
'''MichaelBay, God of [[StuffBlowingUp Very Very Large Explosions]]'''
* Intermediate God
* Symbol: A fiery boom!
* Alignment: ChaoticGood
* Reason for Joining: Wants to see the GUAE at the receiving end of several impressively-large blasts
* Loyalty to Cosmos: She's willing to let him set the above-mentioned reason for joining into motion.
* Threat Level to Melkor: High. Very Very Large Explosions, remember? Melkor does hope he will bankrupt the GUAE though.
''[[TalesOfRebirth Veigue Lungberg]], God of [[SayMyName Name-Yelling]]'''
* Lesser God
* Symbol: His pet Zapii.
* Alignment: ChaoticGood.
* Reason for Joining: '''"KUREAAAAAAAA!!!!!"''' (has been kidnapped by the GUAE, which is too powerful for him alone to defeat)
* Loyalty to Cosmos: "Cosmos is not Claire. She's not Claire. But... I think I can trust her. She did say she'll help me rescue Claire..."
* Threat Level to Melkor:
'''[[FatalFury Terry Bogard]], God of [[GratuitousEnglish Gratuitous Engrish]]''' (Terrence Bogard, Lone Wolf of Southtown)
* Lesser God
* Symbol: His [[NiceHat classic cap]]
* Alignment: NeutralGood
* Reason for Joining: His philosophy is to fight for those who needs help. Besides, he heard that Geese Howard has a shady deal with the GUAE, he know it's got to be something nasty, and needs to be put to stop ASAP.
* Loyalty to Cosmos: High. Gotta respect those who do good.
* Threat Level to Melkor:
'''ArnoldSchwarzenegger''' (Der Gouvernator, TheTerminator) & '''SylvesterStallone''' ([[{{Rocky}} Rocky Balboa]], [[{{Rambo}} John Rambo]], Sly Stallone) '''Gods of [[ActionHero Action Movies]]'''
* Intermediate Gods
* Symbol: Both of them [[WalkingShirtlessScene shirtless]], holding up machine guns.
* Alignment: *insert law scale here* Good
* Reasons for joining: Melkor is a villain planning for nefarious things. It's their job. Moreso for Arnold because his plans include the harm of children he cares about and razing California.
* Loyalty: High for both.
* Threat Level to Melkor: Very High. Both of them are practically [[OneManArmy One Man Armies]] and rather invincible.
'''[[Main/StarTrek James T. Kirk]], God of Space''' (Captain Kirk, William...Shatner, [[BostonLegal Denny Crane]])
* Intermediate God
* Symbol: United Federation of Planets logo
* Alignment: NeutralGood
* Reason for Joining: It... was his duty. And it... had nothing to do with... any of the goddesses!
* Loyalty to Cosmos: Loyal and motivated. Some say this is mostly to top Picard.
* Threat Level to Melkor: High. The hammines be painful to watch, and Kirk can very well seduce most of his female soldiers.
'''[[Main/SailorMoon Setsuna Meio]], Guardian of the Gates of Time''' (Sailor Pluto, Trista)
* Lesser Goddess
* Symbol: The Time Staff
* Alignment: LawfulGood
* Allies: The Sailor Senshi
* Reasong for joining: To ensure that nobody abuses the Gates of Time. And she'd like to make herself known after [[PlutoIsExpendable Pluto is no longer considered a planet]].
* Loyalty to Cosmos: High. Cosmos opposes those who would abuse time and space for their own evil ends.
* Threat Level to Melkor: Medium. TimeStandsStill is a broken ability but the fact that [[DangerousForbiddenTechnique she must die shortly after using it]] sort of mitigates that.
'''[[SuperRobotWars Cobray Gordon]], The Divine [[TimePolice Time Diver]]''' (Time Diver, Ayin)
* Intermediate God
* Symbol: Chibi Dis-Astranagant
* Alignment: NeutralGood
* Reason for Joining: Trying to ensure the stability of the Multiverse's Time and Space, which the GUAE plans to ruin.
* Loyalty to Cosmos: High. She wants the stability of the Multiverse as much as he does.
* Threat Level to Melkor:
'''[[Main/FinalFantasy Cid]], God of [[Main/GlobalAirship Airships]]'''
* Intermediate God
* Symbol: A wrench
* Alignment: Variable (Never ChaoticEvil)
* Reason for joining: He rejected an invite from the GUAE because he had a feeling that his airships would be used as tools of unending war.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/OnePiece Franky]], God of Main/{{Cool Boat}}s''' (Cutty Flam)
* Lesser God
* Symbol: A bottle of Cola
* Alignment: NeutralGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/{{Flash}} Barry Allen, Wally West, and Bart Allen]], Triumvirate of Main/SuperSpeed''' (The Flash, Kid Flash, and Impulse)
* Lesser Gods
* Symbol: A yellow lightning bolt
* Alignment: LawfulGood, NeutralGood, and ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Subaru Nakajima]], Goddess of [[Main/RollerbladeGood Skates]]''' ([=GaoGaiGar-tan=])
* Lesser Goddess
* Symbol: The [[strike: [[GaoGaiGar G-Stone]]]] PowerCrystal on Mach Calibre.
* Alignment: LawfulGood
* Reasong for joining: [[{{Fangirl}} Another chance to fight alongside Nanoha!]] (And [[LesYay Teana]]) Oh, and because it is also the right thing to do for her job.
* Loyalty to Cosmos: Nanoha is friends with (and fights alongside) Cosmos, and thus Subaru does the same.
* Threat Level to Melkor: Moderate normally. High if she ever [[UnstoppableRage goes berserk on the GUAE]].
'''[[Main/ValkyriaChronicles Isara Gunther]], Head of Cute {{Wrench Wench}}es'''
* Demigoddess
* Symbol: Gallian Flag
* Alignment: LawfulGood
* Reason for Joining: She wants to help, that's all.
* Loyalty to Cosmos:
* Threat level to Melkor: Low. Just wait till she gets out of her damn tank...
'''[[Main/{{Discworld}} Rincewind]], God of Running'''
* Demigod
* Symbol: A pointy hat with stars and the word "WIZZARD" on it
* Alignment: TrueNeutral
* Reason for Joining: He knows he'd wind up joining anyway.
* Loyalty to Cosmos: Signed up with Cosmos, because he knew it was inevitable, and he isn't enough of DirtyCoward to ever defect.
* Threat Level to Melkor: High, practically due to Melkor seeing him as practically harmless, and the fact that his luck makes him anything but just that.
'''[[Main/{{Kamen Rider Den-o}} Nogami Ryoutaro]] (Kamen Rider Den-o)''' and '''Senpujin Maito(Brave Express Might Gaine)''', '''Gods of Cool Trains'''
* Lesser Gods
* Symbol: Ryoutaro: Rider Pass, alternatively the Denkamen Sword. Maito: Locomizer.
* Alignment: NeutralGood and LawfulGood respectivly
* Reason for Joining: Because it's the right thing to do. And for Maito trying to prevent Sally's inevitable getting caught in the crossfire and saving her if that doesn't work.
* Loyalty to Cosmos: Maito conciders Cosmos a friend. Ryoutaro is....complicated do to his frequently getting posseced by his Imagin.
'''[[Main/SuperRobotWars Ibis Douglas]], Patron Goddess of Safety From [[Main/CaptainCrash Plane Crashes]]''' (Shooting Star, [[MemeticMutation Love]])
* Lesser Goddess
* Symbol: Chibi Altairlion
* Alignment: LawfulGood
* Reason for Joining: The GUAE represents everything that will hinder her dreams to travel in the sea of stars as well as causing [[CaptainCrash Plane Crashes]] here and there, so she has to stop them. And she believes she can do it!
* Loyalty to Cosmos: Very high. Cosmos likes comforting her whenever she fell into some angst; encouraging her to bloom even further and assured her that she can do it; [[ArsonMurderAndJaywalking and never made a joke about]] [[{{Pettanko}} her breasts]].
* Threat level to Melkor: Moderate. Even Melkor can see her [[MagikarpPower potential]].
'''BruceLee, God of [[IKnowKungFu Martial Arts]]''' (The Dragon)
* Greater God
* Symbol: Dragon
* Alignment: ChaoticGood
* Reason for Joining: He's always fighting evil.
* Loyalty to Cosmos:
* Threat level to Melkor: VERY HIGH. Nothing else needs to be said!
'''[[Main/{{Halo}} Master Chief]], God of Supersoldiers''' (Master Chief Petty Officer SPARTAN-117; John-117; the Chief)
* Intermediate God
* Symbol: A Spartan Helmet.
* Alignment: LawfulGood
* Reason for Joining: Two reasons: the GUAE have the support of the Covenant, and they tried to kill the few other Spartans. Now... he needs a weapon...
* Loyalty to Cosmos: He promised her that he'd help. And when he makes a promise, he keeps it. ...She does know how to pick 'em...
* Threat Level to Melkor: Pretty High. John may not have flashy superpowers, but he's still got billions of enemy kills and two galaxy-saving victories under his belt.
'''[[WalkerTexasRanger Chuck Norris]], God of [[MemeticBadass Ass Kicking]]''' (Cordell Walker)
* Greater God
* Symbol: A Texas Ranger badge
* Alignment: LawfulNeutral
* Reason for Joining: Evil needs a roundhouse kick in the face. Repeatedly. '''[[MemeticBadass A-CHUCK A-NOOOORIIIIIS!!!]]'''
* Loyalty to Cosmos:
* So far only trains some GUAG's troops. But if he were to ever join a fight for real....
* Threat level to Melkor: OFF THE SCALE. [[http://chucknorrisfacts.com/ These are the reasons why]]
'''[[{{Doom}} The Doom Marine]], The Main/OneManArmy'''(The Marine, Flynn Taggert, A Berserker-Packing Man-And-A-Half, Doom Guy)
* Intermediate Deity
* Symbol: His own two hands
* Alignment: ChaoticGood (Hey, he hates demons and likes fluffy bunnies)
* Reason for Joining: He spotted some demons in the GUAE's army. His urge to kill something rose as soon as he saw them.
* Loyalty to Cosmos: She didn't piss him off, the GUAE have. He just asked for a weapon, and Cosmos pointed him to the nearest armory, and according to what she's tells everyone else, he's not going to turn on the good guys, so he can be assumed pretty loyal.
* Threat Level to Melkor: High. This OneManArmy can and would take out a lot of his demonic forces by himself, so Melkor is somewhat concerned.
'''[[TwentyFour Jack Bauer]], God of [[MadeOfIron The Iron-Made]]''' (Badass, A FEDERAL AGENT!)
* Greater God
* Symbol: CTU Badge
* Alignment: ChaoticGood
* Reason for Joining: Homegrown terrorists seem to be the new hot export among the GUAE. As the star member of the CTU, he's determined to stop them. Fast.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[ThreeHundred Leonidas]], [[ThisIsSPARTA GOD! OF! YELLING...er Battle Cries]]''' (King of Sparta, Commander of The 300)
* Intermediate God
* Symbol: A hoplite's shield
* Alignment: ChaoticNeutral
* Reason for Joining: For calling the way of the Spartans 'Madness', Leonidas wants to kick the GUAE to death down a well and make them dine in hell. '''[[ThisIsSPARTA "THIS. IS. SPARTA!!!"]]'''
* Loyalty to Cosmos: High. Cosmos' forces are taking on mighty legions of evil much like he did in his mortal life, so he and his Spartans are willing to fight to the last man alongside them.
* Threat Level to Melkor: Moderate, but Melkor's concerned that taking Leonidas down could cost him a [[{{Understatement}} LOT]] of troops.
'''[[DevilMayCry Dante Sparda]], God of DemonSlaying''' (The Son of Sparda)
* Intermediate God
* Symbol: Rebellion with Ebony and Ivory crossed over the quillions.
* Alignment: ChaoticGood
* Reason for Joining: Oh there's just too much fun and ass-kicking awaiting if he joins the good. Plus, with lots of demons to stay, he'd be stinkin' rich for this job.
* Loyalty to Cosmos: He's always loyal to the contract Cosmos made to him. And while he doesn't look like it, he can't stand evil.
* Threat Level to Melkor: Very High. Being stabbed through the heart doesn't even slow him down, he has a habit of turning defeated enemies into powerful weapons, and he is equal in power to his father, the man (actually demon who turned against his kind to save humanity) who curbstomped the [[{{Satan}} prince of darkness]].
'''[[{{Main/Metroid}} Samus Aran]], Goddess of [[Main/EarthShatteringKaboom Planet Exploding]]''' (The Hunter, the Hatchling, [[Main/IAmNotShazam Metroid]])
* Intermediate God
* Symbol: The Screw Attack sign, Morph Ball, Power Suit
* Alignment: NeutralGood
* Reason for Joining: The GUAE insulted the memory of the Chozo and desecrated Chozo shrines. To Samus, this is an unforgivable offense.
* Loyalty to Cosmos: High. Cosmos promised to let her [[BagOfSpilling keep her upgrades]] when she begins new missions.
* Threat Level to Melkor: Fairly High. She has at least two complete genocides under her belt, and Melkor is understandably nervous about a significant portion of his forces being on planets that could explode at any time.
'''[[RurouniKenshin Kenshin Himura]], God of [[TechnicalPacifist Technical Pacifism]]''' (Battousai)
* Lesser God
* Symbol: Sakabato
* Alignment: NeutralGood
* Reason for Joining: Protecting his loved ones, not killing unnecessarily.
* Loyalty to Cosmos:
* Threat Level to Melkor: Low. He doesn't kill his opponent after all.
'''[[GunBuster Noriko Takaya]], Goddess of [[CallingYourAttacks Attack Calls]]''' ([[spoiler:Nonoriri]])
* Lesser Goddess
* Symbol: Gunbuster in "arms-folded" pose
* Alignment: LawfulGood
* Reason for Joining: Was also asked by Ryusei to join up. She has, and the two of them can't resist going {{Squee}} over the GUAG's mecha together.
* Loyalty to Cosmos: She want to fight for the good guys like her best friend Ryusei, so she's quite loyal.
* Threat Level to Melkor:
'''[[Main/{{DragonBall}} Goku]], God of Main/KiAttacks and [[Main/{{MyKungFuIsStrongerThanYours}} Training]]''' (Kakarot)
* Intermediate God
* Symbol: A 4-Starred Dragon Ball
* Alignment: ChaoticGood
* Reason for Joining: Because he is the hope of the universe. He is the answer to all living things that cry out for peace. He is protector of the innocent. He is the light in the darkness. He is truth. "Ally to good! Nightmare to ''you''!"
* Loyalty to Cosmos: She's good, right? Reason enough.
* Threat Level to Melkor: Pretty High; defender of all that is good + Super Saiyan 3 = trouble for the GUAE
'''[[Main/{{Dragonball}} Vegeta]], Herald of Goku'''
* Quasideity
* Symbol: A broken scouter
* Alignment: Neutral (swings between Law and Chaos depending on the story arc)
* Reason for Joining: The GUAE threatened Trunks.
* Loyalty to Cosmos: Well, he does care about his son, but was more interested in kicking some ass. Cosmos more or less told him to do what he wanted, as long as he left the good guys alone. Thus far, the only people he's beaten the crap out of are GUAE members, and Goku promised Cosmos to keep an eye on him.
* Threat level to Melkor: Low. Another one put on Melkor's 'Those hit with BadassDecay[=/=]{{Chickification}} List'
'''[[Main/ProfessionalWrestling Steve Austin]], God of Asswhuppin' ''' (Stone Cold, The Texas Rattlesnake, The Alcohol-Fueled Whoop-Ass Machine)
* Lesser God
* Symbol: Middle-finger gesture (Stone Cold Salute) and/or skull with smoking eye sockets
* Alignment: ChaoticNeutral
* Reason for Joining: 'Cause Stone Cold says so!
* Loyalty to Cosmos: He was more a little reluctant to join, mostly because he's more than a little bit of a rebel and anti-authority, but considering that the GUAE disgusts him, he told Cosmos he was going to Stone Cold Stunner the GUAE and help out the GUAG, but not because he was loyal, but because they just piss him off. She accepts that, and merely told him she was glad he wasn't an enemy.
* Threat Level to Melkor:
'''[[Main/NinjaGaiden Ryu Hayabusa]], God of [[Main/{{Ninja}} Ninjitsu]]''' (Dragon, Wielder of the Dark Dragon Blade)
* Greater God
* Symbol: Falcon
* Alignment: ChaoticNeutral
* Reason for Joining: The GUAE destroyed his home village. He's out for their ''gory'' blood.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/ProfessionalWrestling Hulk Hogan]], God of Training, Prayers and Vitamins''' (The Hulkster, The Immortal One)
* Lesser God
* Symbol: Anything red and yellow. Including IronMan, on one occasion that they both wish could remain forgotten.
* Alignment: LawfulGood
* Reason for Joining: He's doing it for all the little Hulksters, brother!
* Loyalty to Cosmos: She supports his reasons for joining.
* Threat Level to Melkor:
'''[[Main/MetalGear Solid Snake]], God of Stealth'''
* Lesser God
* Symbol: The FOXHOUND logo, Cardboard Box
* Alignment: NeutralGood
* Reason for Joining: Rumour has it there are Metal Gears in the field.
* Loyalty to Cosmos: Was originally going to inflitrate and destroy the GUAE himself, mostly for the above reason, but Cosmos persuaded him he'd need some support if he was going to get much accomplished, and he was (after a while) convinced she had a point. She also respects that he likes to work alone, so he usually gets the solo sneaking/reconaissance missions.
* Threat level to Melkor: High. He's nearly a OneManArmy in Melkor's opinion.
'''[[Main/{{GhostInTheShell}} Motoko Kusanagi]], Goddess of [[Main/ActionGirl Female Asskicking]]''' (The Major)
* Lesser Goddess
* Symbol: Neck Interface Pattern with a number 9 emblazoned in the center
* Alignment: LawfulNeutral
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor: High.
'''[[Main/{{Firefly}} River Tam]], Goddess of [[Main/WaifFu Petite Warriors]]'''
* Lesser Goddess
* Symbol: A bare foot.
* Alignment: ChaoticGood
* Reason for Joining: Trouble by trouble, two by two, the GUAE recruited the Hands of Blue
* Loyalty to Cosmos:
* Threat Level to Melkor: High. Mal is really resorcefull and charismatic.
'''[[Main/{{X-Men}} Wolverine]], God of Berserker Rage''' (Best There Is At What He Does, Wolvie, Logan, James)
* Lesser God
* Symbol: His fist pointing upward, unbreakable claws extended
* Alignment: ChaoticNeutral, usually leaning Good
* Reason for Joining: The GUAE pissed him off.
* Loyalty to Cosmos: Not comfortable fighting in a group with MAGNETO in it, but what the hell, Cosmos, Magneto, and himself want to kick the same ass, so though he's not much of team player, he told Cosmos he'd be willing to join so he could claw the GUAE to death.
* Threat Level to Melkor:
'''[[Main/{{DoctorWho}} Brigadier Lethbridge-Stewart]], God of [[Main/TheBrigadier Heroic Militaries]]'''
* Quasidiety
* Symbol: the UNIT crest
* Alignment: LawfulNeutral
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/{{Bleach}} Kenpachi Zaraki]], God of [[Main/BloodKnight Blood Knights]] and [[Main/BadassNormal Badass Normals]]''' (Kenny, Ken-chan)
* Intermediate God
* Symbol: A rusty, notched [[Main/KatanasAreJustBetter katana]]
* Alignment: ChaoticNeutral
* Reason for Joining: Too many great fights await! Formed the BloodKnight brigade with Thorkell the Tall and Cu Chullain just to propogate more intense battles!
* Loyalty to Cosmos: Not much, but is more interested in kicking GUAE ass anyway, they look like he'll be having fun for awhile.
* Threat level to Melkor: High. This guy just won't go down... and seems rather TooKinkyToTorture.
'''[[Main/{{Runaways}} Molly Hayes]], Young Goddess of [[Main/CuteBruiser Adorable Power]]''' (Bruiser, Princess Powerful)
* Lesser Goddess (with the physical strength of a Demigoddess)
* Symbol: A cute animal themed hat, of any choice.
* Alignment: LawfulGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Signum]], Goddess of [[Main/LadyOfWar Graceful Battle]]'''
* Lesser Goddess
* Symbol: Her sword Laevatein...burning.
* Alignment: LawfulGood
* Reason for Joining: Hayate Yagami's orders. And her honor as a knight. And so Fate won't show her up.
* Loyalty to Cosmos: Fighting alongside Fate, and her knight's honor would be stained if she aided evil, so she swore fealty to Cosmos.
* Threat Level to Melkor: Signum recently fought Nanoha to a draw in a sparring match. So yeah, pretty damn high... AT FIRST. Once Melkor heard about the incident with Cypha of Huckebein; he immediately put her as 'Low' threat while putting her into 'Those hit with BadassDecay[=/=]{{Chickification}} List'. For Melkor, someone must be able to win even when cheated if they want to be considered of high threat.
** Considering the [[SoLastSeason conditions]] of her [[WorfHadTheFlu defeat]] and the fact that her grudge with Cypha is not decided yet, Cosmos is waiting until Signum awakes to encourage her to achieve recovery and take advantage of Melkor's [[UnderestimatingBadassery understimation]] [[TemptingFate on]] [[LadyOfWar her]] to investigate GUAE's movements and to pursue her awaited rematch with Cypha(with her new [[MidSeasonUpgrade upgrade]] that will let her bypass the [[AntiMagic handicaps]] [[PowerNullifier imposed]] by the [[MageKiller Huckebein]] as explained to Cosmos by Vita).
'''[[Main/ConanTheBarbarian Conan]], God Of [[Main/BarbarianHero Barbarians]]'''
* Greater God
* Symbol: The face of Arnold Schwartzenegger
* Alignment: ChaoticNeutral
* Reason for joining: Melkor is a dark wizard isn't he? Dark wizard killing is Conan's specialty.
* Loyalty to Cosmos: Not loyal to her, but does agree that Melkor is better off very, very dead, so he told her he was helping out.
* Threat Level to Melkor: Very High, especially given Conan is personally gunning for ''him''.
'''[[Main/IkkiTousen Sonsaku Hakufu]], Goddess of Main/{{Panty Fighter}}s''' ({{Baka}})
* Greater Goddess
* Symbol: Magatama, stylishly worn as an earring.
* Alignment: ChaoticGood as her normal self, but her inner dragon can quickly turn her into ChaoticEvil.
* Reason for Joining: For lots of good fights.
* Loyalty to Cosmos: As soon as Cosmos informed her that the GUAE would have no problem hurting those she cares for and beating up the defenseless, she told Cosmos she'd help out, and kick their asses.
* Threat Level to Melkor: Melkor considers her a tactical distraction, and thus, dangerous in a fight.
'''[[Main/StreetFighter Dan Hibiki]], [[Main/JokeCharacter Wannabe God of Badasses]]'''
* Quasideity
* Symbol: His trademark pink gi
* Alignment: ChaoticGood
* Reason for Joining: To promote the Saikyo-Ryu!
* Loyalty to Cosmos:
* Threat level to Melkor: Low. JokeCharacter...
'''[[Main/{{Slayers}} Lina Inverse]], Goddess of Beast Slayers''' (Bandit Killer, Dragon Spooker, Enemy To All Who Live)
* Intermediate Goddess
* Symbol: A sack filled with precious jewels
* Alignment: ChaoticNeutral
* Reason for Joining: The bad guys have money, and she wants to steal it.
* Loyalty to Cosmos:
* Threat level to Melkor: High. Melkor has lots of dragons in disposal, and ''every single of them'' fears Lina. Also, if she ever feels the need to [[DangerousForbiddenTechnique cast Giga Slave]], thus invoking [[Pantheon/MainHouse the Lord of Nightmares]], the war will be over in a heartbeat. The only question (and the main reason why she hasn't already) is whether there will be anything left of the Pantheon afterwards...
'''[[Main/SuperRobotWars Axel Almer]], God of [[{{Determinator}} Determined Warriors]]''' (Ahoseru, Sleeping Prince)
* Lesser God
* Symbol: The head of Soulgain (focus on the moustache)
* Alignment: TrueNeutral. Formerly LawfulNeutral.
* Reason for Joining: He's trying to find a reason to live without warmongering. The GUAE once goaded him to return to his old living style, he refused. The moment he heard that Beowulf might be amongst the ranks of GUAE, he actively opposes them.
* Loyalty to Cosmos: Cosmos has convinced him that there IS a way to live without warmongering, so Axel is loyal to her just as long as she doesn't lie.
* Threat level to Melkor: Moderate-high. This guy's determination to NOT DIE is just first class, and he has always refused to go back to his old lifestyle (which would be beneficial to Melkor).
'''[[Main/ChronoCrusade Rosette Christopher]], Goddess of [[Main/ChurchMilitant Religious Militia]]'''
* Lesser Goddess
* Symbol: A pocket watch
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/TalesOfTheAbyss Jade Curtiss]], God of [[ColonelBadass Colonels]]''' (Jade Balfour, Jade the Necromancer)
* Demigod
* Symbol: Malkuth army symbol
* Alignment: LawfulGood (Arguably LawfulNeutral, or TrueNeutral with good tendencies)
* Reason for Joining: Wily is repeating his old sadistic practices. He's trying to prevent the GUAE from creating another Nebilim.
* Loyalty to Cosmos: He'd say a lot of nasty things to Cosmos, but it's just his way to show his affection and loyalty to her.
* Threat Level to Melkor: High. He's a very powerful mage, is skilled enough in close combat to not be a SquishyWizard or GlassCannon, and has enough strategic and millitary training to be as significant a threat off the battlefield as on it.
'''[[{{F-Zero}} Captain Falcon]], God Of [[MegatonPunch Very Powerful Punches]]'''
* Greater God
* Symbol: A golden falcon
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor: Very High. Not even Melkor can remain unharmed after a [[MemeticMutation FALCOWN PAWNCH]]!!!
'''[[ShadowHearts Yuri Volte Hyuga]], [[DidYouJustPunchOutCthulhu Godslayer]]''' (Rude Hero)
* Demigod
* Symbol: Magatama with a red jewel
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[{{Warhammer 40000}} Alpharius]], God of Cheap Bastards'''
* Lesser God
* Symbol: Green hydra on purple background
* Alignment: ChaoticNeutral
* Reasons for Joining: A chance to defeat the Ultramarines on the field of battle is a chance he will not pass up, but perhaps there is more to his allegiance then what first appears, perhaps he serves a darker master.
* Loyalty to Cosmos: Uncertain, one day he appears her staunchest ally, the other a possible spy, whatever he is, he is not to be trifled with.
* Threat Level to Melkor: Moderate. Melkor thinks he can turn him.
'''[[{{VinlandSaga}} Thorkell the Tall]], God of [[HornyVikings Vikings!]] [[BloodKnight People Who Love To Fight!]] [[BigGuy Giant Raiders!]] and [[CrazyAwesome Feats of Improbable Bad Assery!]]'''
* Lesser God
* Symbol: An Axe and a Giant Log
* Alignment: ChaoticNeutral with some Evil tendencies
* Reason for Joining: It's not because he opposes Evil, he doesn't. It's not because he is loyal to Cosmos, he isn't. It's because he loves the fight, the chance to carve his way through a horde of the strongest warriors ever created, to appraise and out perform his rivals on the side of good. If he finds his rivals fight better than his enemies, well [[HeelFaceRevolvingDoor he'll just find the better fight]]. Member of the BloodKnight brigade alongside his rival Zaraki Kenpachi.
* Loyalty to Cosmos: Zero, he fights for the glory of battle alone.
* Threat Level to Melkor:
'''[[{{S-Cry-Ed}} Kazuma]], God of [[PainfulTransformation Power Despite Pain]]''' (The Shell Bullet, Kazuya, [=NP3228=])
* Greater God
* Symbol: The Shell Bullet arm
* Alignment: ChaoticNeutral
* Reason for Joining: Those bastards in the GUAE remind him of the bastards he fought in life, and not caring how much it hurts, he joined the GUAG to help kick some ass.
* Loyalty to Cosmos: Cosmos found out about his desire to join, and promised him that if he insisted on going OneManArmy on the GUAE, at least let her know first, and she'd make sure the Medical Division was around in case he needed the help. He at first stubbornly said it wasn't necessary, but later told he appreciated it, and said that he wasn't much of a team player, but he would not turn against the GUAG for any reason. Cosmos told him that was fair enough.
* Threat Level to Melkor:
'''Game/MegaMan, God of [[MegaManning Power Replication]]''' (The Blue Bomber)
* Demigod (when not upgraded)
* Symbol: His blue helmet
* Alignment: LawfulGood
* Domain: City, Protection, Law, Good
* Reason for Joining: To fight Dr. Wily. It's ''[[HijackedByGanon always]]'' a Dr. Wily plot.
* Loyalty to Cosmos: They share enemies, and Cosmos approves of his technical pacifist ways, and besides when she pointed out it is possible for Wily to [[MegaManBattleNetwork reform]], he conceded the point, and he's loyal because it's the right thing to do.
* Threat Level to Melkor:
'''[[VagrantStory Ashley Riot]], Patron of {{Physical God}}s''' (Riskbreaker, The Reinforcements, [[WalkingTheEarth The Vagrant]])
* Lesser God.
* Symbol: [[http://www.rpgfan.com/pics/vagrant-story/wall-ashley02.jpg The Rood of Iocus]]
* Alignment: NeutralGood. Maybe.
* Reason for Joining: The GUAE tried to MindScrew him again. He's pissed, and wants to go OneManArmy on them again.
* Loyalty to Cosmos: After the aformentioned mind screwing was over, he signed up with her, knowing she and the GUAG would need "the reinforcements".
* Threat Level to Melkor: High.
'''HonorHarrington, Goddess of Space Navies'''
* Intermediate Deity
* Symbol: Her treecat Nimitz
* Alignment: LawfulGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
''' [[{{Touhou}} Flandre Scarlet,]] {{Ax Crazy}} {{Badass Adorable}} Extraordinaire'''
* Lesser Deity (in terms of influence), Greater Deity (in terms of power)
* Symbol: a complex crest composed of her jeweled wings and her wand superposed over a rune circle
* Alignment: not quite clear, due to complete insanity varies from ChaoticGood / ChaoticNeutral to ChaoticEvil.
* Reason for Joining: Same like Hong Meiling, she wants her sister Remilia, to be deified, first she has to beat down Dracula first. With Sakuya being forced to join the GUAE after deification, Flandre also feels a stronger drive to kick Dio's ass.
* Loyalty to Cosmos: Medium, since Cosmos lets her have her fun... somewhere. However... in any case Sakuya accidentally DIES, Flandre is going to get mad and wreak havoc.
* Threat level to Melkor: VERY HIGH. If Melkor ever gets on her bad side...
'''[[MegaManX Zero]], God of {{Badass}} and [[HairTropes Blonde Hair]]''' (The Crimson Hunter, The Bloody Maverick)
* ???? (Like he does with his hero status, he does not call himself a god. No one's really going to force the issue though)
* Symbol: A [[MegaManX stylized]] [[MegaManZero Z]] overtop of [[MegaManZX Biometal Model Z]]
* Alignment: ChaoticGood....when not in his "Awakened" state. ChaoticEvil when.
* Reason for joining: Most think he's just warming the seat for X. Little do most know is that Cosmos has promised to help find people that can repair Iris (and to curb her rage, Colonel) to full power and Memory. Getting answers from Wily is just icing on the cake really. Lastly, he confirms the GUAE as his enemy, and...
-> "I never cared about justice, and I don't recall ever calling myself a hero... I have always only fought for the people I believe in. I won't hesitate... If an enemy appears in front of me, I will destroy it!"
* Loyalty to Cosmos: This is the best option to keep that promise to that friend. And Cosmos reminds him of Ciel, as well as showing him '''[[{{Narm}} WHATHEISFIGHTINGFOOOOOOOOOOOOOOORRRRRR!!!!]]'''.
* Threat level to Melkor: High. This guy ''completely'' refuses to die and is powerful to the boot.
'''[[{{Daimos}} Kazuya Ryuuzaki]], God of [[MoCapMecha Karate/Kung Fu Robo Pilots]] and [[ThePowerOfLove Those Empowered By Love]]'''
* Lesser God
* Symbol: The head of Daimos
* Alignment: LawfulGood
* Reason for Joining: Defending Earth, justice and... the GUAE is threatening Erika. That he cannot have!
* Loyalty to Cosmos: Very high. Kazuya is a man full of optimism and believes in justice, and Cosmos is not a highly bigoted racist like a certain mortal general that made him sick, so he feels more comfortable on taking her orders.
* Threat Level to Melkor:
'''[[HerculesTheLegendaryJourneys Her]][[Disney/{{Hercules}} cu]][[IncredibleHercules les]], [[WorldsStrongestMan Pantheon's Strongest God]]''' (Heracles, Herc, [[FateStayNight Berserker]])
* Demigod
* Symbol: The nemean lion skin
* Alignment: ChaoticNeutral
* Reason for Joining: Somebody added one more labor to his Twelve Labors, making it Thirteen Labors. And that labor is assisting the GUAG!
* Loyalty to Cosmos:
* Threat level to Melkor: Varies, depending on which persona Herc is having for the day.
'''[[StreetFighter Zangief]], God Of SpinningPileDriver''' ([[RedBaron Red Cyclone]])
* Lesser God
* Symbol: The cape of Red Cyclone
* Alignment: LawfulGood
* Reason for Joining: FOR MOTHER RUSSIA!
* Loyalty to Cosmos: Cosmos didn't think of him and Russia as DirtyCommunist. So for Zangief, Cosmos is a great comrade!
* Threat level to Melkor: Medium.
'''[[Main/MortalKombat Sub-Zero]], God of [[Main/PopsicleSplat Destruction Through]] [[Main/KillItWithIce Freezing]]''' (Kuai Lang, Sub-Zero II)
* Lesser God
* Symbol: The Dragon Medallion
* Alignment: LawfulGood
* Reason for Joining: As another act to redeem the Lin Kuei, as well as looking for his brother Noob Saibot.
* Loyalty to Cosmos: Cosmos is an example of goodness that the Lin Kuei should follow if they want to be redeemed, so Sub-Zero is very loyal to her.
* Threat level to Melkor: High. Nearly as equal to Hyoga in terms of ice power, and he's not afraid to get gory about it. Besides, he was one of the remaining people that remained good/undefeated during the rise of Onaga (and even get more powerful), so that says a lot.
'''[[StreetFighter Chun-Li]], Goddess of [[KickChick Kicking]]''' ([[RedBaron The Strongest Woman In The World]])
* Lesser Goddess
* Symbol: A Qipao or her Lightning Kick
* Alignment: LawfulGood
* Reason for joining: Not only Melkor kidnaps the children she's taking care of, Bison is spotted amongst the GUAE ranks, thus Chun-Li enlists in opposition of him.
* Loyalty to Cosmos: Very high. As a police officer and firm believer of justice, it's the only way to go.
* Threat Level to Melkor: High. She's the first motivator to make ladies kick ass, which is dangerous for Melkor
'''[[FistOfTheNorthStar Rei]], God of [[AbsurdlySharpBlade Absurdly Sharp]] [[FingerPokeOfDoom Fingers]]''' (Star of Justice)
* Intermediate God
* Symbol: Several fingers with some cut motion marks
* Alignment: LawfulGood
* Reason for joining: "I'm the Star of Justice. I live and die for others."
* Loyalty to Cosmos: Cosmos accepted him in warm hands after his messy death and took care and guardianship of his mortal lover Mamiya. Also, based on the quote above, pretty high loyalty.
* Threat Level to Melkor: VERY HIGH. On the same level of Kenshiro, and had it not been due to that unfortunate accident with Raoh, he could've racked an equal amount of Melkor's {{Mook}}s.
'''[[Main/{{Trigun}} Vash]], God of [[Main/ImprobableAimingSkills Marksmanship]]''' (Vash the Stampede, The Humanoid Typhoon)
* Demigod
* Symbol: A silver [[RevolversAreJustBetter Revolver]]
* Alignment: ChaoticGood
* Reason for joining: To remove the $$60,000,000 bounty placed on him.
* Loyalty to Cosmos: And, officially joining the good guys is a nice way to do that, and Cosmos has already started working on that bounty problem of his, so he's loyal.
* Threat Level to Melkor: High. He's a walking disaster after all.
'''[[Main/FinalFantasyVII Cloud Strife]], God of [[Main/{{BFS}} Swordsmanship]]''' (Spiky, The SOLDIER)
* Greater God
* Symbol: His Buster Sword
* Alignment: ChaoticGood
* Reason for joining: To defend what he thinks is right, by his own feeling, not because someone told him to.
* Loyalty to Cosmos: [[DissidiaFinalFantasy Has fought on Cosmos' side before]].
* Threat Level to Melkor: Meklor considers him a wuss and doesn't place him high on his threat list. Wether he's underestmating Cloud or not remains to be seen.
'''[[Main/AvatarTheLastAirbender Sokka]], God of [[Main/{{PrecisionGuidedBoomerang}} Boomerangs]]''' (Meat and Sarcasm Guy, Wang Fire)
* Quasideity
* Symbol: Boomerang
* Alignment: LawfulGood
* Reason for joining: Sokka feels that Aang's lack of tactical skill could get him in trouble, so Sokka tags along to make sure the kid doesn't do something too reckless.
* Loyalty to Cosmos:
* Threat Level to Melkor: Moderate-Low, whilst only a normal, he TookALevelInBadass in the later stages of the war with the Fire Nation and has a fair amount of inventing and tactical prowess
'''Jackie Chan, God of Main/{{Improvised Weapon}}ry'''
* Lesser God
* Symbol: Fist, Foot, Chair, Table, Mop, Ladder, Microwave, Kitchen Sink etc.
* Alignment: NeutralGood
* Reason for joining: A chance to fight alongside BruceLee that he respects. And to prevent the GUAE to give everyone 'Bad Days'
* Loyalty to Cosmos: He's always fought for the good guys, so he joined her side to do that.
* Threat Level to Melkor: High. Since EVERYTHING can become a weapon around him.
'''[[Main/{{RatchetAndClank}} Ratchet]], God of [[Main/{{BFG}} Firepower]]'''
* Intermediate Deity
* Symbol: The [[Main/{{InfinityPlusOneSword}} RYNO]], although a wrench is also used.
* Alignment: NeutralGood (originally TrueNeutral)
* Reason for joining: Was kinda semi drafted into joining.....
* Loyalty to Cosmos: ....though he has been paid pretty good since he was here, and he happens to like the good guys (Cosmos especially), so SureWhyNot be loyal.
* Threat Level to Melkor: very high, to date his best weapons have been know as the RYNO (Rip You a New One) RYNO II, RY3NO (Rip You 3 New Ones), RYNOCIRATOR, RYNO IV, RYNO IV Extreme, RYNO 4-Ever, RYNO V, and the Omega RYNO V. all of which have been blacklisted by all sane and most insane people, the last 5 had their plans torn up and scatted and the last three could get you 10 life sentences in the worst prison imaginable just for talking about them. add to that the 100 or so OTHER weapons he has and you are looking at a [[Main/{{OneManArmy}} one lombax army]]. As long as either Gadgetron, Megacorps, [=GrummelNet=] or other companies still produce weaponry, Ratchet will always remain a massive threat. Then again, if Melkor becomes a customer...
'''[[Main/BabylonFive John Sheridan]], God of [[NukeEm Nukes]].'''
* Demigod
* Symbol: The BabylonFive insignia.
* Alignment: LawfulGood
* Reason for joining: The bad guys like WMD's too much, and use them on innocent people FAR too much. As God of Nukes, he's going to PayEvilUntoEvil (albeit within reason).
* Loyalty to Cosmos: Not explicitly loyaly, but he does respect her ideals and the side of good, so he's a team player.
* Threat Level to Melkor:
'''[[Main/{{Castlevania}} Simon Belmont]], God of [[Main/WhipItGood Whipping]]'''
* Demigod
* Symbol: Vampire Killer Whip, plus a Holy Cross nearby.
* Alignment: LawfulNeutral
* Reason for joining: Familial duty to destroy Dracula and his evil allies.
* Loyalty to Cosmos: Cosmos is the epitome of good that vanquishes the terrible night. Why wouldn't he be loyal?
* Threat Level to Melkor: Very high, as Simon has an incredible amount of experience taking down high-powered Dark Lords with very little equipment or high-level skill.
'''[[Main/JusticeLeague Shayera Hol]], Goddess of [[DropTheHammer Blunt Weaponry]]''' (Hawkgirl)
* Demigoddess
* Symbol: A morning star
* Alignment: LawfulGood
* Reason for joining: To fight the forces of evil... and to smash shit.
* Loyalty to Cosmos: A bit scornful of serving any god/dess (even though she is one), but at least Cosmos holds good in high regard and is not someone she minds helping out.
* Threat Level to Melkor:
'''[[Main/FateStayNight Cu Chulainn]], Lord of the [[Main/BladeOnAStick Spear]]''' ([[Main/EveryoneCallsHimBarkeep Lancer]])
* Demigod
* Symbol: Gae Bolg
* Alignment: LawfulNeutral, though he was originally ChaoticNeutral. He blames Main/TypeMoon for this shift (though not that he regrets it).
* Reason for joining: There'll be lots of unrestrained good fights!
* Loyalty to Cosmos: Just as long as Cosmos doesn't restrain him or betray him, he's cool with her. Thus far, she hasn't.
* Threat Level to Melkor:
'''[[Main/{{Donkey Kong}} Donkey Kong]], God Of [[Main/{{Abnormal Ammo}} Strange Ammo]] And Barrel Throwing'''
* Lesser God
* Symbol: A Barrel with the letters DK on it
* Alignment: LawfulGood (except when opposing Mario; then he is more on the evil side)
* Reason for joining: He and Mario don't get along much, but he can accept much bigger threats are their mutual foes, so he and Mario will be in EnemyMine against the GUAE.
* Loyalty to Cosmos: Cosmos accepted his willingness to join, as long as he is willing to put aside his hatred for now, and DK can do that, and Mario isn't all that worked up either, so he's fairly loyal.
* Threat Level to Melkor: Moderate. His weaponry is unconventional, but he has super strength and sizable clan of like-powered apes and jungle fauna to back him up, and unconventional weaponry is hard to prepare for.
'''[[Main/GuiltyGear Millia Rage]], Goddess of [[Main/PrehensileHair Weaponized Hair]]'''
* Demigoddess
* Symbol: The Assassin Syndicate logo, slashed down the middle
* Alignment: TrueNeutral
* Reason for joining: ZATO-1/Eddie's in the GUAE.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Vita]], Goddess of [[Main/DropTheHammer Hammers]]''' (Wolkenritter, The Iron Hammer Knight)
* Lesser Goddess
* Symbol: Her [[NiceHat hat]], with Graf Eisen nearby.
* Alignment: LawfulGood
* Reason for joining: Hayate Yagami's orders. and to test her worthiness as Guy's successor in wielding the Goldion Crusher.
* Loyalty to Cosmos: Her senpai (Guy Shishioh) has joined the cause, and she wants to drop the hammer on Melkor's face repeatedly, because her senpai would do no less, so yeah, she's sworn loyalty.
* Threat Level to Melkor: Moderate normally; High if the GUAE were to ever damage her hat and/or threaten Hayate.
'''[[Main/{{Gundam 00}} Lockon Stratos]], God of [[Main/FriendlySniper Sniping]]''' (Neil Dylandy, [[StupidSexyFlanders Stupid Sexy]] [[FanNickname Lockon]])
* Lesser God
* Symbol: Orange Haro with word bubble "Lockon, Lockon, Lockon"
* Alignment: TrueNeutral
* Reason for joining: To stop and defeat Ali Al-Saachez, but he's not doing it for [[ItsPersonal personal revenge anymore]], but because Ali is that dangerous to the community.
* Loyalty to Cosmos: She wants sick bastards like the one he fought stopped. He will fight for that cause, and joined hers.
* Threat Level to Melkor:
'''[[Main/GearsofWar Marcus Fenix]], God of [[ChainsawGood Chainsaws]]'''
* Demigod
* Symbol: Crimson Omen
* Alignment: NeutralGood
* Reason for joining: Rumor has it that the GUAE are recruiting Locust forces into their army.
* Loyalty to Cosmos: When he heard Simon was going to shove a drill up evil's ass, he signed up with Cosmos so he could do the same with his chainsaw.
* Threat Level to Melkor: Moderate; no powers, but has accomplished too much badassery to be marked "Low".
'''[[SuperDimensionFortressMacross Max Jenius]], God of [[MacrossMissileMassacre Missile Swarms]]''' (Max Sterling)
* Lesser God
* Symbol: UN Spacy Logo
* Alignment: LawfulGood
* Reason for joining: Because [[WordOfGod awesomeness incarnate]] is what he is, and it's always fought for good before.
* Loyalty to Cosmos: Even after ascension, he still doesn't want to see body counts like he saw during the Zentradi War to ever pile up again, and thus he's back in the fight, willingly aiding Cosmos' side.
* Threat Level to Melkor: High. While missiles pose little threat to Mekor, the sheer number might prove fatal.
'''[[VisionOfEscaflowne Van Fanel]], God of Angelic Beefcakes'''
* Lesser God
* Symbol: Angelic wings
* Alignment: LawfullGood
* Reason for joining: Duty, to protect his people and Hitomi.
* Loyalty to Cosmos: High. Respect her and her attempts to end the war.
* Threat Level to Melkor: Very High. Not only is he one hell of a swordsman, but he also has the [[HumongousMecha Escaflowne]], the "God of War" at his at his disposal.
'''[[RomanceOfTheThreeKingdoms Huang Zhong]], God of [[TheArcher Archery]]'''
* Lesser God
* Symbol: The flag of the Shu kingdom
* Alignment: NeutralGood
* Reason for joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[SaintSeiya Ikki]], current God of Rebirth''' (Phoenix, The Knight of Hope)
* Greater God
* Symbol: Phoenix
* Alignment: ChaoticGood
* Reason for Joining: He finds the current godly job boring and tiresome and he so loves a good fight. And since he hates evil with a passion, unleashing his anger on the GUAE seemed like an excellent idea.
* Loyalty to Cosmos: He respects her but does not swear loyality to anyone. He also likes to work alone. While that might be problematic, Cosmos has gladly accepted him due to sheer power, even tough some other members of the aliance are concerned with his constant power increase.
* Threat Level to Melkor: High to Extreeme...depending on how many times he ressurects and thus, doubles his power. Melkor ordered his troops to try not to kill him, but the result is an increasingly rising bodycount.
'''[[Main/MarvelUniverse Black Bolt]], God of [[Main/MakeMeWannaShout Voice Weapons]]''' (Blackagar Boltagon, King of the Inhumans)
* Intermediate God
* Symbol: His helmet on the Inhumans insignia.
* Alignment: TrueNeutral
* Reason for joining: The GUAE contains the likes of the Skrull or at least those who had the same mindset, and they threaten the Inhumans. As a King, Black Bolt must take action. Besides, fellow Illuminati IronMan, Reed Richards and DoctorStrange have joined, thus he also joins in the fray.
* Loyalty to Cosmos: Cosmos saved him from the hole that he created during [[WarOfKings his climatic battle against Vulcan]], and had gently reprimanded him of how insane his plan could be, and promised him a way to achieve his goal without a plan that insane. Black Bolt is interested.
* Threat level to Melkor: Moderate. Melkor would've put him in the 'Those hit with BadassDecay[=/=]{{Chickification}} List', but his inanely broken power is too dangerous to overlook.
'''[[Main/TokusouSentaiDekaranger Doggie Kruger]], God of [[Main/BadassFurry Badass Furries]]''' (Boss, The Guard Dog From Hell, [=DekaMaster=])
* Intermediate God
* Symbol: His S.P.D badge (the one with number 100)
* Alignment: LawfulGood
* Reason for joining: Helping out Tommy to lead the SPD in the battle against evil greater than the Alienizers, and cutting down hundreds of evildoers.
* Loyalty to Cosmos: Very High.
* Threat level to Melkor: Quite High. A powerful swordsman... and 'killing' him doesn't always guarantee his death.
'''[[GuiltyGear Potemkin]] and [[BlazBlue Iron Tager]], Gods of [[MightyGlacier Slow-As-Hell Powerhouses]]''' ([[RedBaron Red Devil]] (Tager))
* Lesser Gods
* Symbol: A triangular link between Zepp's Symbol, Sector Seven's Symbol and Tager's crest. They're huge.
* Alignment: LawfulNeutral
* Reason for joining: Both Zepp and Kokonoe have aligned themselves to the GUAG in order to defeat many of their enemies, including That Man, I-No, Terumi.
* Loyalty to Cosmos: Depends on their leaders. President Gabriel of Zepp gets along fine with Cosmos, so Potemkin's loyalty is assured. However, Kokonoe can get a bit moody and Tager's loyalty depends if Kokonoe really wants to stay.
* Threat level to Melkor: Medium. They're REALLY powerful. But they're slow as a molass...
'''[[Main/{{Halo}} The 7th ODST Battalion]], House of Defense Special Forces, Gods of [[ItsRainingMen Orbital Insertions]]''' (The Helljumpers)
* Demigod Squadron
* Symbol: [[http://images4.wikia.nocookie.net/halo/images/c/c4/7thODSTunitpatch.PNG]]
* Alignment: LawfulNeutral (Overall; individuals range across the Good and Neutral (except Neutral Evil) spectrums)
* Reason for joining: The GUAE have recruited the Covenant. Gunnery-Sergeant Buck's response to his troops? "You know the music, boys; time to dance!"
* Loyalty to Cosmos: Chain of command
* Threat Level to Melkor: Moderate; stand no chance against the GUAE's big names, but against the GUAE's {{Mooks}} the Helljumpers are virtually unstoppable.
'''[[Main/{{Warhammer40k}} Adeptus Astrates]], Ultimate Special Forces, Gods of [[SuperArmy Godly armies]]''' (Space Marines, Angels of Death)
* God Squadron
* Symbol: Crux Terminatus
* Alignment: Lawful Badass
* Reason for joining: To purge the filth of Chaos
* Loyalty to Cosmos: Chain of command
* Threat Level to Melkor: Extreeme. Melkor is scared of them, but luckily for him, they come in only occasionally and in small numbers. However, even then they butchered his forces.
'''[[XWingSeries Wedge Antilles]], God of {{Ascended Extra}}s and [[LaResistance The Rebellion]]''' (Rogue One, Wraith One, Commander Antilles, ''General'' Antilles, Red One, Wedgan'tilles(Slayer Of Stars), Blackmoon Eleven aka The Greatest Pilot Of All Time, "Veggies", "Lt. Kettch", "[[NewJediOrder Vader]]")
* Demigod. He's declined promotion so far. We'll see how long that lasts.
* Symbol: His helmet, complete with the little check marks. Since his squadrons followed him, they brought their two crests and the symbol of the Rebellion.
* Alignment: He checked LawfulGood on the form, but there are times when he finds the rules too arbitrary to bother with.
* Reason for joining: A chance to kick the Empire's ass
* Loyalty to Cosmos: As long as they share enemies (which is more or less a given), he and his forces shall serve her.
* Threat Level to Melkor: not that high by themselves, but they pose a huge threat to the Death Star. Not to mention, Wraith Squadron's shenanigans make the Emperor, Darth Vader, and the 501st very, very nervous...
'''[[SailorMoon Tuxedo Mask]], God of [[MysteriousProtector Mysterious Protectors]]''' (Mamoru Chiba, Darien Shields, Moonlight Knight, Prince Endymion)
* Lesser God
* Symbol: a rose, mask and top hat
* Alignment: ChaoticGood
* Reason for joining: To protect and assist Sailor Moon.
* Loyalty to Cosmos: As he knows from personal experience (having been used by evil briefly during a MindScrew and mostly fighting against it), it needs a champion to oppose it, and since Cosmos is the epitome of the good Sailor Moon would fight for, he pledged his services.
* Threat Level to Melkor: Low-Moderate in direct combat, since most of Melkor's minions' defenses are sufficient to block precision rose throwing; he's mostly dangerous in the sense of being key to the motivation and mental health of Sailor Moon, who is a much heavier hitter. Has the potential to be more of a moderate-high threat if he ever taps into his potential or starts using armor and a sword, but that happens very rarely these days.
'''[[{{Gargoyles}} Goliath]], God of [[HurtingHero Emotionally Wounded Heroes]]'''
* Demigod
* Symbol: Clawmarks in stone
* Alignment: NeutralGood.
* Reason for joining: He and his clan initially wanted to remain neutral, but he couldn't stomach the thought of criminals hurting the innocent, and neither could they, so he offered his services.
* Loyalty to Cosmos: Fairly strong. She made sure they'd have adequate backup (in case the sun or reasonable facsimilie shows up to ruin their efforts), and he in exchange pledged to help her stop the spread of their evil.
* Threat Level to Melkor:
'''ThePhantomStranger''', '''God of Mysteries'''
* Divine Level: Unknown. (It's a mystery.)
* Symbol: Blank eyes shadowed by the brim of a hat.
* Alignment: LawfulGood (though some people wonder...)
* Reason For Joining: The Phantom Stranger ''always'' shows up when a CrisisCrossover involving the supernatural happens. Though nobody knows exactly when, or what he will do, or when he will leave.
* Loyalty to Cosmos: Unknown, though Cosmos believes she can trust him.
* Threat Level to Melkor: [[RuleOfThree Also unknown]]. Many have their suspicions, but nobody knows for certain.
'''[[{{Warhammer 40000}} The Catachan Devil]], DeathWorld Incarnate'''
* Lesser Deity
* Symbol: Open maw with many, many fangs.
* Alignment: Chaotic Hungry
* Reason For Joining: With the call of Ibram Gaunt, Ciaphas Cain, and Leman Russ to war, the Catachan Jungle Fighters under their command brought the Catachan Devil with them.
* Loyalty to Cosmos: So long as it's well fed, it's happy.
* Threat Level to Melkor:
'''{{Bayonetta}}, Goddess of [[FetishFuelStationAttendant Fetish Fuels]]'''
* Lesser Goddess
* Symbol: Both her guns... with some hairs nearby.
* Alignment: TrueNeutral
* Reason For Joining: Those angels who slew the whole Umbra Witches are actually minions of Mildred Avalon (Jubileus was her decoy). Bayonetta feels an urge to punch her, and anyone who's allied with her, into the sun. The money's nice too, as well as a chance of fighting anything else other than angels.
* Loyalty To Cosmos: Cosmos protected her from Madame Butterfly's deal of 'Sacrifice Angels or I'll damn you to hell'. With new height of freedom to do what she wants, Bayonetta trusts her.
* Threat Level to Melkor: Moderate-high. Melkor knew how she could pull off things BeyondTheImpossible and if he's not careful, he ''might'' be the one who gets punched from Pluto to Sun. But, as of now the GUAE Intelligence Department have been researching ways to reapply Madame Butterfly's deal, in which Bayonetta would have no choice but to make a FaceHeelTurn, thus becoming their ally.
'''[[Main/MassEffect Legion]], Deity (Deities?) Of [[Main/MindHive Mind Hives]]'''
* Demideity (or Demideities?)
* Symbol: a piece of N7 armor. Alternately, the [[Main/{{BFG}} M-98 Widow]] [[Main/SniperRifle Anti-Materiel Rifle]]
* Alignment: True Neutral
* Reason for joining: Joined because the 'Old Machines' and the heretic Geth joined the GUAE.
* Loyalty to Cosmos: The 'Old Machines' joined the GUAE. Cosmos opposes the GUAE. Cosmos opposes the 'Old Machines'. Cooperation furthers mutual goals.
* Threat Level To Melkor: Moderate
'''[[MassEffect Urdnot Wrex]], God of [[ProudWarriorRaceGuy Proud Warrior Race]]s'''
* Demigod
* Symbol: A futuristic assault rifle
* Alignment: Chaotic Good
* Reason for joining: He thinks he'll get a good fight as well as believing that anyone who fights the GUAG is either stupid or on Melkor's payroll. Killing both is for the good of the universe. Gets along well-enough with other Blood Knights, though he is comparatively less reckless.
* Loyalty to Cosmos: Moderate. She's got a good cause to fight for and better enemies to fight against.
* Threat Level To Melkor: High. Not only is he a powerful warior by himself, being skilled in biotics and weaponry, he also leads an army of Proud Warrior Races that has been convinced to fight for their lives if they stick with him.
'''[[MassEffect Mordin Solus]], God of [[DeadlyDoctor Surprisingly Lethal Healers]]'''
* Demigod
* Symbol: The tattoo design upon his forehead
* Alignment: Neutral Good
* Reason for joining: Wishes to seek atonement for past actions. Also, GUAE uses reprehensible science. Unacceptable experiments. Unacceptable goals. Have to kill them.
* Loyalty to Cosmos: High. All life precious. Cosmos protects life.
* Threat Level: Seen as Low. Much more dangerous than that. Easily underestimated.
'''[[Main/OnePiece Roronoa Zoro]], God of DualWielding and CutlassBetweenTheTeeth''' (Pirate Hunter, Mr. Bushido, Kenshi-San, Demon Cutter Zoro, Supernova)
* Intermediate God
* Symbol: 3 Swords, or Green Dragon, his jolly roger
* Alignment: Chaotic Good
* Reason for joining:
* Loyalty to Cosmos:
* Threat Level To Melkor:
'''[[{{Pokemon}} Zubat]], [[GoddamnedBats God...damned Bat]]'''
* Quasideity (yeah, right)
* Symbol: An EyelessFace and a pair of bat fangs
* Alignment: [[strike: Chaotic Evil]] True Neutral
* Reason for joining: As a pokemon, is loyal to Poke-[[TheMessiah Messiah Ash]], who joined. Zubat simply followed.
* Loyalty to Cosmos:Chain of command, and besides, Zubat knows that it has no chance of becoming Crobat if gets a trainer as unfriendly as one of the GUAE.
* Threat level to Melkor: Medium low. Extremely annoying to any of Melkor's minions, at the very least.
'''[[Main/KamenRiderDecade Tsukasa Kadoya]], God of [[ShapeshifterWeapon Using allies]] [[BodyHorror as Weapons ]]''' (KamenRiderDecade, Decade, Destroyer of Worlds)
* Lesser God (due to calling in favours)
* Symbol: The Kamen Rider Decade Symbol
* Alignment: Chaotic Good
* Reason for joining: Has journeyed throughout many worlds and saw Melkor's antics. Personally, he's ticked and decides to oppose him.
* Loyalty to Cosmos: High. Has learned a lot about loyalty thanks to staying in the Toku Base and his journeys with Yuusuke Onodera and Natsumi Hikari.
* Threat Level to Melkor: High. The man is many opposing heroes rolled up in one. Then there's his title and he pretty much lived up to it.
* Message to the GUAE: "Just a passing through KamenRider. Remember it well!"
'''[[Main/SuperRobotWarsAlpha Baran Doban]], God of [[EpicFlail Flails]]'''
* Intermediate God
* Symbol: The Bemidoban, with its flail ready, and seemingly singing "Ware koso waaa... Ware koso waaa... BARAN DOBAN!"
* Alignment: NeutralGood
* Reason for joining: To show the pride of the reformed Balmar warriors.
* Loyalty to Cosmos: Cosmos has forgiven his crimes as a Balmarian who tried conquering the galaxy, so Baran is grateful.
* Threat level to Melkor: High. No one, not even Melkor, wants to get hit with a gigantic iron ball traveling in a speed faster than light...
'''[[Main/{{Warhammer 40000}} Ursarkar E. Creed]], God of [[Main/{{MaryTzu}} Tactical Geniuses]]'''
* Lesser God
* Symbol: Someone angryly yelling his name
* Alignment: Neutral Good
* Reason for joining: ???
* Loyalty to Cosmos: ???
* Threat level to Melkor: Extermely High
'''[[DragonQuest Erdrick]], God[[{{AFGNCAAP}} (dess)]] of [[HeroicLineage Heroic Lineages]]''' (Loto, [[SpellMyNameWithAnS Roto]], Hero, Three, [[HelloInsertNameHere Insert Name Here]])
* Greater God[[{{AFGNCAAP}} (dess)]]
* Symbol: A stylized bird of prey
* Alignment: LawfulGood in poltics, manner, and strategy, with forays into ChaoticGood [[KleptomaniacHero whenever s/he sees something valuable]]
* Reason for Joining: That Melkor guy sounds like a demonic Lord of Evil. After killing two and helping arrange for the death of a third, killing those guys is basically hir ''hobby''.
* Loyalty to Cosmos: High. She's a cosmic being of light and goodness who empowers and guides heroes. Erdrick obeys without question, and quietly wonders if its relevant that s/he has never seen Cosmos and Rubiss in the same place at the same time.
* Threat Level: Very, very, very high. S/he took out the seemingly all-powerful {{Evil Overlord}}s Baramos and Zoma ([[{{AFGNCAAP}} possibly by hirself]]), and has a legion of trained heroic descendants, each of whom is capable of doing much the same.
'''[[Main/MahouSenseiNegima Miyazaki Nodoka]], Goddess of [[TookALevelInBadass Taking A Level In Badass]]''' (Pudica Bibliothecaria, Honya)
* Lesser Goddess
* Symbol: Her Diarium Ejus
* Alignment: Lawful Good
* Reason for joining: She wasn't going to sit back and do nothing while Negi-sense and Yue got involved.
* Loyalty to Cosmos: Cosmos allowed Yue to read her mind, Yue is incredibly loyal to her... unless Negi-sensei says otherwise.
* Threat Level: Nodoka might be very capable, but in a fight she is rated low-medium. However, Melkor has a price on her head to motivate his armies if they spot her. Because as a support unit her artifact makes her an '''extreme''' threat to him. Many other members of the GUAE feel the same way. Nodoka is constantly being escorted places for this reason.
* Lesser Goddess
* Symbol: The Glyph symbol
* Alignment: NeutralGood
* Reason for joining: Invited by Simon Belmont and Adrian Fahrenheight Tepes to destroy Dracula.
* Loyalty to Cosmos: Cosmos also noticed her heroism and is willing to make her name not disappear from history, while making sure the power of the Glyphs are not misused, earning Shanoa's trust.
* Threat level to Melkor: Low. Melkor knows what she could do thanks to Dracula, and when compared to the Belmonts, she's seen to be kind of lacking.
'''[[SuperRobotWars Selena Recital]], Goddess of [[{{Gainaxing}} Bouncing]] [[JigglePhysics Breasts]]'''
* Lesser Goddess
* Symbol: [[strike:Chibi Alegrias]] Her breasts, ever in motion. ([[http://img467.imageshack.us/img467/4840/akibakko11601860049024sh5.gif seen here]])
* Alignment: True Neutral
* Reason for joining: To arouse the good guys with her {{Fanservice}}. Also, she opposes Keisar Ephes and the SRW villians in the GUAE, and is joining to make them pay for one of their agents murdering her squadmates awhile back.
* Loyalty to Cosmos: Even if she [[HeelFaceRevolvingDoor looks as if she switches allegiance too much]], she is still loyal to Cosmos and will eventually return to her.
* Threat Level to Melkor:
'''[[Main/SaintSeiya Virgo Shaka]], God of [[Main/EyesAlwaysShut Constantly-Slitted Eyes]]''' (Virgo Saint, Buddha incarnate)
* Greater God
* Symbol: Virgo Golden Cloth
* Alignment: LawfulGood
* Reason for joining: It's his duty as a Gold Saint to defend the good.
* Loyalty to Cosmos:
* Threat Level to Melkor: Very High to Extreeme if he opens his eyes. If not, High. But Melkor pisses him off, so the very high estiamte might be more accurate.
'''[[RaidouKuzunohaVsTheSoullessArmy Raidou Kuzunoha the 14th]], God of [[NiceHat Hats]]'''
* Lesser God
* Symbol: His hat (obviously)
* Alignment: LawfulGood
* Reason for Joining: A GUAE member shot at his hat (they missed, but ''still''...)
* Loyalty to Cosmos: She likes the hat and doing the right thing. Loyalty confirmed.
* Threat Level to Melkor:
'''[[BlazBlue Bang Shishigami]], God of HighlyVisibleNinja'''
* Lesser God
* Symbol: The Ikaruga crest, with his nail nearby.
* Alignment: LawfulGood
* Reason for joining: To uphold love, and justice, and eventually use his fame and prowess to eventually rebuild Ikaruga! [[Pantheon/BookOfTrope As well as protecting Miss Litchi from any bad guidances after she has been rescued]].
* Loyalty to Cosmos: Very high. Cosmos could turn Jin Kisaragi that he hated into a genuine force of good, and upholds justice well.
* Threat level to Melkor: Pending. He's always seen as a joke by Melkor, but it has been discovered that he's training to use a Nox Nyctores. Threat level waiting until Melkor can gauge what the Nox can do.
'''[[GGundam Schwarz Bruder]], God of [[McNinja Non-Japanese Ninja]]''' ([[spoiler:Kyoji Kasshu]])
* Lesser God
* Symbol: His German Mask, next to the head of Spiegel Gundam
* Alignment: TrueNeutral
* Reason for joining: Claims to be watching over and helping Domon, but he might have some ulterior motives. Whatever it is, it's not of nasty thoughts.
* Loyalty to Cosmos: Cosmos restored him, his Gundam, AND his ninja skills. He's good with her.
* Threat Level to Melkor:
'''[[Main/{{Narnia}} Aslan]], God of [[Main/CrystalDragonJesus Religious Metaphors]]''' (King Of Beasts, The Lion, The Lamb)
* Greater God
* Symbol: A White Lamb...no, wait, a Lion...no wait, a lamb!
* Alignment: Lawful Good
* Reason for Joining: It was foretold at the beginning of all things.
* Loyalty to Cosmos: Very strong.
* Threat Level to Melkor: High.
'''[[Main/WonderWoman Diana of Themiscyra]], Goddess of Truth''' (Wonder Woman)
* Intermediate Goddess
* Symbol: Double letter W, or golden eagle
* Alignment: LawfulGood
* Reason for Joining: To defend those that cannot defend themselves.
* Loyalty to Cosmos: Hold Cosmos in high regard as a strong woman committed to justice. Loyalty high.
* Threat Level to Melkor: High.
'''[[{{Main/ShinMegamiTenseiNocturne}} Naoki Kashima]], Fulcrum of Order and Chaos''' (Demi-Fiend, Hitoshura)
* Demi...Fiend
* Symbol: A demonic magatama
* Alignment: TrueNeutral, edging towards NeutralGood
* Reason for Joining: He's supposed to be a neutral force, but Cosmos' side eventually won out.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''Main/LeeroyJenkins, The Destroyer Of Philosophies'''
* Intermediate God
* Symbol: A mountain of fried chickens
* Alignment: [[LawfulStupidChaoticStupid Chaotic Stupid]]
* Reason for joining: No reason. He's just there to jump off into the fray of battle, kick ass while yelling "'''LEEROOOOYYYY!!! JEEEENKIIINNNSS!!!'''"
* Loyalty to Cosmos: No loyalty. He's just on Cosmos' side because he's a Paladin, and Paladins aren't supposed to be with evil.
* Threat level to Melkor: Moderate. Supposedly low, since he's a liability to the good guys. But there are times when Leeroy goes over the top in his charge and actually becomes an OneManArmy, so... Melkor reconsiders.
'''[[StreetFighter Ryu]], God of [[ToBeAMaster Those Who Wants To Be The Best]]'''
* Intermediate God
* Symbol: HADOKEN!
* Alignment: TrueNeutral
* Reason for joining: To have a chance to fight many powerful evil Gods.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Vivio Takamachi]], Goddess of [[Main/CloneJesus Cloned Messiahs]]''' (The Saint King, The Sankt Kaiser, Sankt Regina Olivie)
* Intermediate Goddess
* Symbol: The head of Sacred Heart, her bunny plushie Device.
* Alignment: NeutralGood
* Reason for joining: Accompanying Nanoha-mama and Fate-mama.
* Loyalty to Cosmos: Cosmos is nice to her mamas ''and'' to her, so Vivio likes her.
* Threat Level to Melkor: Moderate. She's seen to have taken levels in badass. And Melkor knew what happened to the poor bitch who tried kidnapping her and triggering the wrath of Nanoha...
'''[[GunXSword Van]], God of [[IHaveManyNames Men With Multiple Names]] and Patron Protector of Weddings''' (Van the Devil Swallowtail Suit, Van of the Dawn (his favorite), Van That Weird Guy Who Helped Out, [[GratuitousEnglish Van Za Naisu Gai]], Pretty Van From The Garbage Dump... gah, too many to list)
* Lesser God
* Symbol: [[HumongousMecha Dann of Thursday]]
* Alignment: TrueNeutral (with some ChaoticGood tendencies)
* Reason for joining: Protecting the sacredness of wedding that the GUAE is threatening. That, and the GUAE has many people like The Claw, better kill'em before they hurt anyone else.
* Loyalty to Cosmos: Cosmos reminded him of Elena and showed him a way to fight without relying on revenge, thus Van is grateful.
* Threat Level to Melkor: High, Melkor's aware of what this guy has accomplished with ThePowerOfLove powering his RoaringRampageOfRevenge.
'''[[Main/{{Watchmen}} Doctor Manhattan]], God of [[Main/{{YouCantFightFate}} Fatalism]]''' (Jon Osterman)
* Intermediate God
* Symbol: A hydrogen atom
* Alignment: TrueNeutral (can tend towards NeutralGood)
* Reason for Joining: To protect the innocent, and because as far as he is concerned, he already joined next week years ago.
* Loyalty to Cosmos: He finds her resolve and empathy endearing, if not inspiring.
* Threat Level to Melkor: High. Manhattan may not believe he can fight fate, but when he bothers trying, things '''explode.'''
'''[[Main/GauntsGhosts Saint]] [[{{Warhammer 40000}} Sabbat]], God of [[Main/BecauseDestinySaysSo Predetermined Fate]]''' (The Saint, The Beati)
* Intermediate Goddess
* Symbol: The flower Islumbine
* Alignment: ChaoticGood
* Reason for Joining: Aids Cosmos' mission against the GUAE, which is tied to her her goal of opposing Chaos.
* Loyalty to Cosmos: Cosmos is in direct opposition to Chaos, whose gods are high ranking commanders in the GUAE. Loyalty is thus quite high.
* Threat Level to Melkor:
'''[[Main/{{Persona3}} Mitsuru Kirijo]], Goddess of FateWorseThanDeath''' (Mitsuru-senpai)
* Lesser Goddess
* Symbol: The Kirijo group badge
* Alignment: LawfulGood
* Reason for joining: To uphold the honor of the Kirijo family.
* Loyalty to Cosmos: Betrayal would mean repeating the same disgraces that the family committed in the past, so she's really loyal to her.
* Threat Level to Melkor:
'''[[Main/RanmaOneHalf Ranma Saotome]], God ''and'' Goddess of [[Main/GenderBender Gender Bending]]''' (Aquatranssexual, Ranko)
* Male/Female Quasideity
* Symbol: A bucket and kettle
* Alignment: ChaoticNeutral
* Reason for Joining: He ordinarily wouldn't care, but considering the GUAE hired Shinji Matou to go around raping women in the GUAG, even he was horrified, especially when that ''bastard tried to have a go at him!'' That said, he joining the good guys to hunt him down and kick his ass!
* Loyalty to Cosmos: Moderate-High, believe or not. The fact she hasn't given him grief over his curse or tried to become another member of his UnwantedHarem was several points in her favor.
* Threat Level to Melkor: High enough that Melkor keeps a RightHandCat and a bucket of cold water nearby at all times.
'''[[Main/{{Discworld}} Angua von Uberwald]], Goddess of [[Main/OurWerewolvesAreDifferent Werecreatures]]''' (Sergeant Angua)
* Lesser Deity
* Symbol: A badge of the Ankh-Morpork City Watch, on a dog-collar
* Alignment: LawfulGood
* Reason for Joining: Well, her boss and boyfriend are already opposing evil, and besides, the GUAE has many who discriminate against those like herself and she wants to keep them from harming her followers.
* Loyalty to Cosmos: Following her boss and boyfriend's lead, and is sympathetic to Cosmos' ideals of peace.
* Threat Level to Melkor:
'''[[{{Hellsing}} Alucard]], God of [[HealingFactor Regeneration]] and Hell Hounds'''
* Greater God
* Symbol: Demonic grin, tongue hanging out
* Alignment: LawfulEvil
* Reason for Joining: Orders from Sir Integra, and a chance to cut loose!
* Loyalty to Cosmos: Has some respect for her but his loyalty is to Integra.
* Threat Level to Melkor: High. He is Vlad the Impaler and downright crazy. Melkor does hope he can get him to switch sides.
'''[[StreetFighter Edmond Honda]], God of Sumo'''
* Lesser God
* Symbol: His face-marking.
* Alignment: ChaoticNeutral
* Reason for Joining: Promoting Sumo. Oh, and having lots of good fights too.
* Loyalty to Cosmos: Cosmos likes sumo. Honda is always good with those who likes sumo.
* Threat Level to Melkor:
'''[[{{Transformers}} Optimus Prime]], God of Mecha''' (Peterbilt, Peter Cullen, [[TransformersGeneration1 TRUKK]], Optronix, Orion Pax)
* Lesser God... apparently. He goes toe-to-toe with some Greater Gods without coming off second best.
* Symbol: The Autobot emblem
* Alignment: LawfulGood
* Reason for Joining: Because freedom is the right of all sentient beings, and the GUAE would take away that freedom.
* Loyalty to Cosmos: High
* Threat Level to Melkor: Fairly High; Melkor remembers what happened to Megatron, Starscream, Grindor, and The Fallen last time Optimus cut loose.
'''[[FullmetalAlchemist Alphonse Elric]], God of Machines''' (The Living Armor)
* Intermediate God
* Symbol: A metallic arm, the helmet that is his head
* Alignment: NeutralGood
* Reason for Joining: He was promised to gain back his body and be reunited with his family.
* Loyalty to Cosmos:
* Threat Level to Melkor: Low, unless Ed shows up, in which case it can be upgraded to Medium.
'''[[FantasticFour Reed Richards]], God of Comic Book Science.'''
* Intermediate God
* Symbol: A circle with a four in it.
* Alignment: NeutralGood
* Reason for Joining: Its the right thing to do, and like Tony he feels the need to make up for his actions during the Civil War.
* Loyalty to Cosmos:
* Threat Level to Melkor: Moderate-low, hem may have superpowers, range, and high resistance to bludgeons, but, after all, ReedRichardsIsUseless.
'''[[Main/SuperRobotWars Ryusei Date]], God of [[Main/AscendedFanboy Ascended Fanboys]]'''
* Lesser God
* Symbol: Chibi R-1.
* Alignment: LawfulGood
* Reason for joining: Because it's right. It also gives him the chance to fulfill his greatest dream of being a good ol' SuperRobot hero fighting against ultimate evil.
* Loyalty to Cosmos: He's a good guy, she Good incarnate. He's totally loyal.
* Threat level to Melkor: Moderate-High. His Psychodriver power is not to be underestimated.
'''[[CaptainN Kevin Keene]] and [[CaptainSNES Alex Williams]], Dueling Gods of [[MassiveMultiplayerCrossover Video Game Crossovers]]''' (Captain N, Captain SNES)
* Quasideity (Kevin), Demigod (Alex)
* Symbols: A Zapper light gun and an NES controller (Kevin), a Super Scope (Alex)
* Alignment: NeutralGood (Kevin), ChaoticGood (Alex)
* Reason for joining: For Kevin, he wants to have a chance to [[PacManFever have a correct grasp on videogame character images]]. For Alex, he claims to be doing it as part of a deal to get his pants back, but many suspect he simply desires to have a chance to be a hero without being someone's UnwittingPawn for once.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/SamuelLJackson Samuel L. Jackson]], God of [[Main/SoulBrotha BMFs]]''' ([[PulpFiction Jules Winnfield]], [[DieHard Zeus Carver]], [[StarWars Mace Windu]], [[SnakesOnAPlane Agent Neville Flynn]], [[MarvelUniverse Nick Fury]], and many more.)
* Intermediate God
* Symbol: A wallet that says Bad Motherfucker
* Alignment: ChaoticNeutral
* Reasong for joining: "Enough is enough! I have HAD it with these MOTHERFUCKING evils on this MOTHERFUCKING Pantheon!!"
* Loyalty to Cosmos: Hey, God saved his life once, motherfucker. Cosmos might as well be an aspect of that, so he's told her he was helping out to show the GUAE why he's a "bad motherfucker".
* Threat Level to Melkor: High. Do you not understand the term [[ExactlyWhatItSaysOnTheTin "Bad Motherfucker?"]]
'''[[Main/MahouSenseiNegima Evangeline A.K. [=McDowell=]]], Goddess of [[Main/ElegantGothicLolita Goth Loli]]''' (Eva, Student #26, The Doll Master, The Dark Evangel, The Undying Mage, Apostle of Destruction, Demon king in the form of a child, The advent of evil, Demon lord of darkness, [[strike: Kitty]])
* Intermediate Goddess
* Symbol: The moon
* Alignment: ChaoticNeutral
* Reason for Joining: Because deep down she knows it's the right thing to do; she will, however, VIOLENTLY deny this if asked, stating she's "looking for more dark disciples".
* Loyalty to Cosmos: Little. according to her, she's just helping for the above reason. However, Cosmos has privately told others Evangeline's a better person than she appears, and she's not worried about anything.
* Threat Level to Melkor: Fairly High. Evangeline may be nowhere near as evil/vicious as her reputation states, but she's just as powerful.
'''[[Main/SaturdayNightLive Bill Brasky]], God of [[Main/MemeticBadass Legendary Deeds]]''' (The Divine Son of a Bitch)
* Greater God
* Symbol: A barracuda eating Neil Armstrong
* Alignment: TrueNeutral
* Reason for Joining: Remember that time when blood shot out of Melkor's nose for the first time in, like, ever? Yeah, Bill Brasky did that. A toast! To Bill Brasky!
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''Main/{{Deadpool}}, Destroyer of the Main/FourthWall''' (Merc With a Mouth, Wade Wilson)
* Intermediate God
* Symbol: a yellow narrative box
* Alignment: ChaoticNeutral
* Reason for Joining: The GUAE are no fun!
* Loyalty to Cosmos:
* Threat Level to Melkor: VERY High, due to his [[Main/GenreSavvy Genre Savviness]] and blatant ignorance of the [[Main/FourthWallObserver fourth wall]] allowing him to know just about everything there is to know about Melkor, including some more embarrassing details.
** When really pissed off, Deadpool becomes EXTREME threat because of one thing: He'd break the ultimate Fourth Wall, tell all tropers to delete Melkor and all of his existence from TVTropes and destroy the GUAE in instant (with his gun pointed at the tropers' head to seal the deal). AndThatsTerrible.
'''[[Main/TheAdventuresOfDoctorMcNinja Dr. McNinja]], God of Main/CrazyAwesome'''
* Intermediate God
* Symbol: The mask and the white coat
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor: High. The whole McNinja clan is utterly unpredicatable and dangerous.
'''[[MontyPythonAndTheHolyGrail Sir Robin]], God of [[LovableCoward Charming Cowardice]]''' (Brave Sir Robin, The Not-Quite-So-Brave-As-Sir Lancelot)
* Quasideity
* Symbol: Black chicken
* Alignment: LawfulGood
* Reason for joining: He doesn't know. He just want to stay out of danger, but [[strike:Arthur]] Arturia commands him, so he had to obey.
* Loyalty to Cosmos:
* Threat level to Melkor: Low. He's only good at this command... '''"RUN AWAAAAAAYYYYY!!!!"'''
'''MichaelBay, God of [[StuffBlowingUp Very Very Large Explosions]]'''
* Intermediate God
* Symbol: A fiery boom!
* Alignment: ChaoticGood
* Reason for Joining: Wants to see the GUAE at the receiving end of several impressively-large blasts
* Loyalty to Cosmos: She's willing to let him set the above-mentioned reason for joining into motion.
* Threat Level to Melkor: High. Very Very Large Explosions, remember? Melkor does hope he will bankrupt the GUAE though.
''[[TalesOfRebirth Veigue Lungberg]], God of [[SayMyName Name-Yelling]]'''
* Lesser God
* Symbol: His pet Zapii.
* Alignment: ChaoticGood.
* Reason for Joining: '''"KUREAAAAAAAA!!!!!"''' (has been kidnapped by the GUAE, which is too powerful for him alone to defeat)
* Loyalty to Cosmos: "Cosmos is not Claire. She's not Claire. But... I think I can trust her. She did say she'll help me rescue Claire..."
* Threat Level to Melkor:
'''[[FatalFury Terry Bogard]], God of [[GratuitousEnglish Gratuitous Engrish]]''' (Terrence Bogard, Lone Wolf of Southtown)
* Lesser God
* Symbol: His [[NiceHat classic cap]]
* Alignment: NeutralGood
* Reason for Joining: His philosophy is to fight for those who needs help. Besides, he heard that Geese Howard has a shady deal with the GUAE, he know it's got to be something nasty, and needs to be put to stop ASAP.
* Loyalty to Cosmos: High. Gotta respect those who do good.
* Threat Level to Melkor:
'''ArnoldSchwarzenegger''' (Der Gouvernator, TheTerminator) & '''SylvesterStallone''' ([[{{Rocky}} Rocky Balboa]], [[{{Rambo}} John Rambo]], Sly Stallone) '''Gods of [[ActionHero Action Movies]]'''
* Intermediate Gods
* Symbol: Both of them [[WalkingShirtlessScene shirtless]], holding up machine guns.
* Alignment: *insert law scale here* Good
* Reasons for joining: Melkor is a villain planning for nefarious things. It's their job. Moreso for Arnold because his plans include the harm of children he cares about and razing California.
* Loyalty: High for both.
* Threat Level to Melkor: Very High. Both of them are practically [[OneManArmy One Man Armies]] and rather invincible.
'''[[Main/StarTrek James T. Kirk]], God of Space''' (Captain Kirk, William...Shatner, [[BostonLegal Denny Crane]])
* Intermediate God
* Symbol: United Federation of Planets logo
* Alignment: NeutralGood
* Reason for Joining: It... was his duty. And it... had nothing to do with... any of the goddesses!
* Loyalty to Cosmos: Loyal and motivated. Some say this is mostly to top Picard.
* Threat Level to Melkor: High. The hammines be painful to watch, and Kirk can very well seduce most of his female soldiers.
'''[[Main/SailorMoon Setsuna Meio]], Guardian of the Gates of Time''' (Sailor Pluto, Trista)
* Lesser Goddess
* Symbol: The Time Staff
* Alignment: LawfulGood
* Allies: The Sailor Senshi
* Reasong for joining: To ensure that nobody abuses the Gates of Time. And she'd like to make herself known after [[PlutoIsExpendable Pluto is no longer considered a planet]].
* Loyalty to Cosmos: High. Cosmos opposes those who would abuse time and space for their own evil ends.
* Threat Level to Melkor: Medium. TimeStandsStill is a broken ability but the fact that [[DangerousForbiddenTechnique she must die shortly after using it]] sort of mitigates that.
'''[[SuperRobotWars Cobray Gordon]], The Divine [[TimePolice Time Diver]]''' (Time Diver, Ayin)
* Intermediate God
* Symbol: Chibi Dis-Astranagant
* Alignment: NeutralGood
* Reason for Joining: Trying to ensure the stability of the Multiverse's Time and Space, which the GUAE plans to ruin.
* Loyalty to Cosmos: High. She wants the stability of the Multiverse as much as he does.
* Threat Level to Melkor:
'''[[Main/FinalFantasy Cid]], God of [[Main/GlobalAirship Airships]]'''
* Intermediate God
* Symbol: A wrench
* Alignment: Variable (Never ChaoticEvil)
* Reason for joining: He rejected an invite from the GUAE because he had a feeling that his airships would be used as tools of unending war.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/OnePiece Franky]], God of Main/{{Cool Boat}}s''' (Cutty Flam)
* Lesser God
* Symbol: A bottle of Cola
* Alignment: NeutralGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/{{Flash}} Barry Allen, Wally West, and Bart Allen]], Triumvirate of Main/SuperSpeed''' (The Flash, Kid Flash, and Impulse)
* Lesser Gods
* Symbol: A yellow lightning bolt
* Alignment: LawfulGood, NeutralGood, and ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Subaru Nakajima]], Goddess of [[Main/RollerbladeGood Skates]]''' ([=GaoGaiGar-tan=])
* Lesser Goddess
* Symbol: The [[strike: [[GaoGaiGar G-Stone]]]] PowerCrystal on Mach Calibre.
* Alignment: LawfulGood
* Reasong for joining: [[{{Fangirl}} Another chance to fight alongside Nanoha!]] (And [[LesYay Teana]]) Oh, and because it is also the right thing to do for her job.
* Loyalty to Cosmos: Nanoha is friends with (and fights alongside) Cosmos, and thus Subaru does the same.
* Threat Level to Melkor: Moderate normally. High if she ever [[UnstoppableRage goes berserk on the GUAE]].
'''[[Main/ValkyriaChronicles Isara Gunther]], Head of Cute {{Wrench Wench}}es'''
* Demigoddess
* Symbol: Gallian Flag
* Alignment: LawfulGood
* Reason for Joining: She wants to help, that's all.
* Loyalty to Cosmos:
* Threat level to Melkor: Low. Just wait till she gets out of her damn tank...
'''[[Main/{{Discworld}} Rincewind]], God of Running'''
* Demigod
* Symbol: A pointy hat with stars and the word "WIZZARD" on it
* Alignment: TrueNeutral
* Reason for Joining: He knows he'd wind up joining anyway.
* Loyalty to Cosmos: Signed up with Cosmos, because he knew it was inevitable, and he isn't enough of DirtyCoward to ever defect.
* Threat Level to Melkor: High, practically due to Melkor seeing him as practically harmless, and the fact that his luck makes him anything but just that.
'''[[Main/{{Kamen Rider Den-o}} Nogami Ryoutaro]] (Kamen Rider Den-o)''' and '''Senpujin Maito(Brave Express Might Gaine)''', '''Gods of Cool Trains'''
* Lesser Gods
* Symbol: Ryoutaro: Rider Pass, alternatively the Denkamen Sword. Maito: Locomizer.
* Alignment: NeutralGood and LawfulGood respectivly
* Reason for Joining: Because it's the right thing to do. And for Maito trying to prevent Sally's inevitable getting caught in the crossfire and saving her if that doesn't work.
* Loyalty to Cosmos: Maito conciders Cosmos a friend. Ryoutaro is....complicated do to his frequently getting posseced by his Imagin.
'''[[Main/SuperRobotWars Ibis Douglas]], Patron Goddess of Safety From [[Main/CaptainCrash Plane Crashes]]''' (Shooting Star, [[MemeticMutation Love]])
* Lesser Goddess
* Symbol: Chibi Altairlion
* Alignment: LawfulGood
* Reason for Joining: The GUAE represents everything that will hinder her dreams to travel in the sea of stars as well as causing [[CaptainCrash Plane Crashes]] here and there, so she has to stop them. And she believes she can do it!
* Loyalty to Cosmos: Very high. Cosmos likes comforting her whenever she fell into some angst; encouraging her to bloom even further and assured her that she can do it; [[ArsonMurderAndJaywalking and never made a joke about]] [[{{Pettanko}} her breasts]].
* Threat level to Melkor: Moderate. Even Melkor can see her [[MagikarpPower potential]].
'''BruceLee, God of [[IKnowKungFu Martial Arts]]''' (The Dragon)
* Greater God
* Symbol: Dragon
* Alignment: ChaoticGood
* Reason for Joining: He's always fighting evil.
* Loyalty to Cosmos:
* Threat level to Melkor: VERY HIGH. Nothing else needs to be said!
'''[[Main/{{Halo}} Master Chief]], God of Supersoldiers''' (Master Chief Petty Officer SPARTAN-117; John-117; the Chief)
* Intermediate God
* Symbol: A Spartan Helmet.
* Alignment: LawfulGood
* Reason for Joining: Two reasons: the GUAE have the support of the Covenant, and they tried to kill the few other Spartans. Now... he needs a weapon...
* Loyalty to Cosmos: He promised her that he'd help. And when he makes a promise, he keeps it. ...She does know how to pick 'em...
* Threat Level to Melkor: Pretty High. John may not have flashy superpowers, but he's still got billions of enemy kills and two galaxy-saving victories under his belt.
'''[[WalkerTexasRanger Chuck Norris]], God of [[MemeticBadass Ass Kicking]]''' (Cordell Walker)
* Greater God
* Symbol: A Texas Ranger badge
* Alignment: LawfulNeutral
* Reason for Joining: Evil needs a roundhouse kick in the face. Repeatedly. '''[[MemeticBadass A-CHUCK A-NOOOORIIIIIS!!!]]'''
* Loyalty to Cosmos:
* So far only trains some GUAG's troops. But if he were to ever join a fight for real....
* Threat level to Melkor: OFF THE SCALE. [[http://chucknorrisfacts.com/ These are the reasons why]]
'''[[{{Doom}} The Doom Marine]], The Main/OneManArmy'''(The Marine, Flynn Taggert, A Berserker-Packing Man-And-A-Half, Doom Guy)
* Intermediate Deity
* Symbol: His own two hands
* Alignment: ChaoticGood (Hey, he hates demons and likes fluffy bunnies)
* Reason for Joining: He spotted some demons in the GUAE's army. His urge to kill something rose as soon as he saw them.
* Loyalty to Cosmos: She didn't piss him off, the GUAE have. He just asked for a weapon, and Cosmos pointed him to the nearest armory, and according to what she's tells everyone else, he's not going to turn on the good guys, so he can be assumed pretty loyal.
* Threat Level to Melkor: High. This OneManArmy can and would take out a lot of his demonic forces by himself, so Melkor is somewhat concerned.
'''[[TwentyFour Jack Bauer]], God of [[MadeOfIron The Iron-Made]]''' (Badass, A FEDERAL AGENT!)
* Greater God
* Symbol: CTU Badge
* Alignment: ChaoticGood
* Reason for Joining: Homegrown terrorists seem to be the new hot export among the GUAE. As the star member of the CTU, he's determined to stop them. Fast.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[ThreeHundred Leonidas]], [[ThisIsSPARTA GOD! OF! YELLING...er Battle Cries]]''' (King of Sparta, Commander of The 300)
* Intermediate God
* Symbol: A hoplite's shield
* Alignment: ChaoticNeutral
* Reason for Joining: For calling the way of the Spartans 'Madness', Leonidas wants to kick the GUAE to death down a well and make them dine in hell. '''[[ThisIsSPARTA "THIS. IS. SPARTA!!!"]]'''
* Loyalty to Cosmos: High. Cosmos' forces are taking on mighty legions of evil much like he did in his mortal life, so he and his Spartans are willing to fight to the last man alongside them.
* Threat Level to Melkor: Moderate, but Melkor's concerned that taking Leonidas down could cost him a [[{{Understatement}} LOT]] of troops.
'''[[DevilMayCry Dante Sparda]], God of DemonSlaying''' (The Son of Sparda)
* Intermediate God
* Symbol: Rebellion with Ebony and Ivory crossed over the quillions.
* Alignment: ChaoticGood
* Reason for Joining: Oh there's just too much fun and ass-kicking awaiting if he joins the good. Plus, with lots of demons to stay, he'd be stinkin' rich for this job.
* Loyalty to Cosmos: He's always loyal to the contract Cosmos made to him. And while he doesn't look like it, he can't stand evil.
* Threat Level to Melkor: Very High. Being stabbed through the heart doesn't even slow him down, he has a habit of turning defeated enemies into powerful weapons, and he is equal in power to his father, the man (actually demon who turned against his kind to save humanity) who curbstomped the [[{{Satan}} prince of darkness]].
'''[[{{Main/Metroid}} Samus Aran]], Goddess of [[Main/EarthShatteringKaboom Planet Exploding]]''' (The Hunter, the Hatchling, [[Main/IAmNotShazam Metroid]])
* Intermediate God
* Symbol: The Screw Attack sign, Morph Ball, Power Suit
* Alignment: NeutralGood
* Reason for Joining: The GUAE insulted the memory of the Chozo and desecrated Chozo shrines. To Samus, this is an unforgivable offense.
* Loyalty to Cosmos: High. Cosmos promised to let her [[BagOfSpilling keep her upgrades]] when she begins new missions.
* Threat Level to Melkor: Fairly High. She has at least two complete genocides under her belt, and Melkor is understandably nervous about a significant portion of his forces being on planets that could explode at any time.
'''[[RurouniKenshin Kenshin Himura]], God of [[TechnicalPacifist Technical Pacifism]]''' (Battousai)
* Lesser God
* Symbol: Sakabato
* Alignment: NeutralGood
* Reason for Joining: Protecting his loved ones, not killing unnecessarily.
* Loyalty to Cosmos:
* Threat Level to Melkor: Low. He doesn't kill his opponent after all.
'''[[GunBuster Noriko Takaya]], Goddess of [[CallingYourAttacks Attack Calls]]''' ([[spoiler:Nonoriri]])
* Lesser Goddess
* Symbol: Gunbuster in "arms-folded" pose
* Alignment: LawfulGood
* Reason for Joining: Was also asked by Ryusei to join up. She has, and the two of them can't resist going {{Squee}} over the GUAG's mecha together.
* Loyalty to Cosmos: She want to fight for the good guys like her best friend Ryusei, so she's quite loyal.
* Threat Level to Melkor:
'''[[Main/{{DragonBall}} Goku]], God of Main/KiAttacks and [[Main/{{MyKungFuIsStrongerThanYours}} Training]]''' (Kakarot)
* Intermediate God
* Symbol: A 4-Starred Dragon Ball
* Alignment: ChaoticGood
* Reason for Joining: Because he is the hope of the universe. He is the answer to all living things that cry out for peace. He is protector of the innocent. He is the light in the darkness. He is truth. "Ally to good! Nightmare to ''you''!"
* Loyalty to Cosmos: She's good, right? Reason enough.
* Threat Level to Melkor: Pretty High; defender of all that is good + Super Saiyan 3 = trouble for the GUAE
'''[[Main/{{Dragonball}} Vegeta]], Herald of Goku'''
* Quasideity
* Symbol: A broken scouter
* Alignment: Neutral (swings between Law and Chaos depending on the story arc)
* Reason for Joining: The GUAE threatened Trunks.
* Loyalty to Cosmos: Well, he does care about his son, but was more interested in kicking some ass. Cosmos more or less told him to do what he wanted, as long as he left the good guys alone. Thus far, the only people he's beaten the crap out of are GUAE members, and Goku promised Cosmos to keep an eye on him.
* Threat level to Melkor: Low. Another one put on Melkor's 'Those hit with BadassDecay[=/=]{{Chickification}} List'
'''[[Main/ProfessionalWrestling Steve Austin]], God of Asswhuppin' ''' (Stone Cold, The Texas Rattlesnake, The Alcohol-Fueled Whoop-Ass Machine)
* Lesser God
* Symbol: Middle-finger gesture (Stone Cold Salute) and/or skull with smoking eye sockets
* Alignment: ChaoticNeutral
* Reason for Joining: 'Cause Stone Cold says so!
* Loyalty to Cosmos: He was more a little reluctant to join, mostly because he's more than a little bit of a rebel and anti-authority, but considering that the GUAE disgusts him, he told Cosmos he was going to Stone Cold Stunner the GUAE and help out the GUAG, but not because he was loyal, but because they just piss him off. She accepts that, and merely told him she was glad he wasn't an enemy.
* Threat Level to Melkor:
'''[[Main/NinjaGaiden Ryu Hayabusa]], God of [[Main/{{Ninja}} Ninjitsu]]''' (Dragon, Wielder of the Dark Dragon Blade)
* Greater God
* Symbol: Falcon
* Alignment: ChaoticNeutral
* Reason for Joining: The GUAE destroyed his home village. He's out for their ''gory'' blood.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/ProfessionalWrestling Hulk Hogan]], God of Training, Prayers and Vitamins''' (The Hulkster, The Immortal One)
* Lesser God
* Symbol: Anything red and yellow. Including IronMan, on one occasion that they both wish could remain forgotten.
* Alignment: LawfulGood
* Reason for Joining: He's doing it for all the little Hulksters, brother!
* Loyalty to Cosmos: She supports his reasons for joining.
* Threat Level to Melkor:
'''[[Main/MetalGear Solid Snake]], God of Stealth'''
* Lesser God
* Symbol: The FOXHOUND logo, Cardboard Box
* Alignment: NeutralGood
* Reason for Joining: Rumour has it there are Metal Gears in the field.
* Loyalty to Cosmos: Was originally going to inflitrate and destroy the GUAE himself, mostly for the above reason, but Cosmos persuaded him he'd need some support if he was going to get much accomplished, and he was (after a while) convinced she had a point. She also respects that he likes to work alone, so he usually gets the solo sneaking/reconaissance missions.
* Threat level to Melkor: High. He's nearly a OneManArmy in Melkor's opinion.
'''[[Main/{{GhostInTheShell}} Motoko Kusanagi]], Goddess of [[Main/ActionGirl Female Asskicking]]''' (The Major)
* Lesser Goddess
* Symbol: Neck Interface Pattern with a number 9 emblazoned in the center
* Alignment: LawfulNeutral
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor: High.
'''[[Main/{{Firefly}} River Tam]], Goddess of [[Main/WaifFu Petite Warriors]]'''
* Lesser Goddess
* Symbol: A bare foot.
* Alignment: ChaoticGood
* Reason for Joining: Trouble by trouble, two by two, the GUAE recruited the Hands of Blue
* Loyalty to Cosmos:
* Threat Level to Melkor: High. Mal is really resorcefull and charismatic.
'''[[Main/{{X-Men}} Wolverine]], God of Berserker Rage''' (Best There Is At What He Does, Wolvie, Logan, James)
* Lesser God
* Symbol: His fist pointing upward, unbreakable claws extended
* Alignment: ChaoticNeutral, usually leaning Good
* Reason for Joining: The GUAE pissed him off.
* Loyalty to Cosmos: Not comfortable fighting in a group with MAGNETO in it, but what the hell, Cosmos, Magneto, and himself want to kick the same ass, so though he's not much of team player, he told Cosmos he'd be willing to join so he could claw the GUAE to death.
* Threat Level to Melkor:
'''[[Main/{{DoctorWho}} Brigadier Lethbridge-Stewart]], God of [[Main/TheBrigadier Heroic Militaries]]'''
* Quasidiety
* Symbol: the UNIT crest
* Alignment: LawfulNeutral
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/{{Bleach}} Kenpachi Zaraki]], God of [[Main/BloodKnight Blood Knights]] and [[Main/BadassNormal Badass Normals]]''' (Kenny, Ken-chan)
* Intermediate God
* Symbol: A rusty, notched [[Main/KatanasAreJustBetter katana]]
* Alignment: ChaoticNeutral
* Reason for Joining: Too many great fights await! Formed the BloodKnight brigade with Thorkell the Tall and Cu Chullain just to propogate more intense battles!
* Loyalty to Cosmos: Not much, but is more interested in kicking GUAE ass anyway, they look like he'll be having fun for awhile.
* Threat level to Melkor: High. This guy just won't go down... and seems rather TooKinkyToTorture.
'''[[Main/{{Runaways}} Molly Hayes]], Young Goddess of [[Main/CuteBruiser Adorable Power]]''' (Bruiser, Princess Powerful)
* Lesser Goddess (with the physical strength of a Demigoddess)
* Symbol: A cute animal themed hat, of any choice.
* Alignment: LawfulGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Signum]], Goddess of [[Main/LadyOfWar Graceful Battle]]'''
* Lesser Goddess
* Symbol: Her sword Laevatein...burning.
* Alignment: LawfulGood
* Reason for Joining: Hayate Yagami's orders. And her honor as a knight. And so Fate won't show her up.
* Loyalty to Cosmos: Fighting alongside Fate, and her knight's honor would be stained if she aided evil, so she swore fealty to Cosmos.
* Threat Level to Melkor: Signum recently fought Nanoha to a draw in a sparring match. So yeah, pretty damn high... AT FIRST. Once Melkor heard about the incident with Cypha of Huckebein; he immediately put her as 'Low' threat while putting her into 'Those hit with BadassDecay[=/=]{{Chickification}} List'. For Melkor, someone must be able to win even when cheated if they want to be considered of high threat.
** Considering the [[SoLastSeason conditions]] of her [[WorfHadTheFlu defeat]] and the fact that her grudge with Cypha is not decided yet, Cosmos is waiting until Signum awakes to encourage her to achieve recovery and take advantage of Melkor's [[UnderestimatingBadassery understimation]] [[TemptingFate on]] [[LadyOfWar her]] to investigate GUAE's movements and to pursue her awaited rematch with Cypha(with her new [[MidSeasonUpgrade upgrade]] that will let her bypass the [[AntiMagic handicaps]] [[PowerNullifier imposed]] by the [[MageKiller Huckebein]] as explained to Cosmos by Vita).
'''[[Main/ConanTheBarbarian Conan]], God Of [[Main/BarbarianHero Barbarians]]'''
* Greater God
* Symbol: The face of Arnold Schwartzenegger
* Alignment: ChaoticNeutral
* Reason for joining: Melkor is a dark wizard isn't he? Dark wizard killing is Conan's specialty.
* Loyalty to Cosmos: Not loyal to her, but does agree that Melkor is better off very, very dead, so he told her he was helping out.
* Threat Level to Melkor: Very High, especially given Conan is personally gunning for ''him''.
'''[[Main/IkkiTousen Sonsaku Hakufu]], Goddess of Main/{{Panty Fighter}}s''' ({{Baka}})
* Greater Goddess
* Symbol: Magatama, stylishly worn as an earring.
* Alignment: ChaoticGood as her normal self, but her inner dragon can quickly turn her into ChaoticEvil.
* Reason for Joining: For lots of good fights.
* Loyalty to Cosmos: As soon as Cosmos informed her that the GUAE would have no problem hurting those she cares for and beating up the defenseless, she told Cosmos she'd help out, and kick their asses.
* Threat Level to Melkor: Melkor considers her a tactical distraction, and thus, dangerous in a fight.
'''[[Main/StreetFighter Dan Hibiki]], [[Main/JokeCharacter Wannabe God of Badasses]]'''
* Quasideity
* Symbol: His trademark pink gi
* Alignment: ChaoticGood
* Reason for Joining: To promote the Saikyo-Ryu!
* Loyalty to Cosmos:
* Threat level to Melkor: Low. JokeCharacter...
'''[[Main/{{Slayers}} Lina Inverse]], Goddess of Beast Slayers''' (Bandit Killer, Dragon Spooker, Enemy To All Who Live)
* Intermediate Goddess
* Symbol: A sack filled with precious jewels
* Alignment: ChaoticNeutral
* Reason for Joining: The bad guys have money, and she wants to steal it.
* Loyalty to Cosmos:
* Threat level to Melkor: High. Melkor has lots of dragons in disposal, and ''every single of them'' fears Lina. Also, if she ever feels the need to [[DangerousForbiddenTechnique cast Giga Slave]], thus invoking [[Pantheon/MainHouse the Lord of Nightmares]], the war will be over in a heartbeat. The only question (and the main reason why she hasn't already) is whether there will be anything left of the Pantheon afterwards...
'''[[Main/SuperRobotWars Axel Almer]], God of [[{{Determinator}} Determined Warriors]]''' (Ahoseru, Sleeping Prince)
* Lesser God
* Symbol: The head of Soulgain (focus on the moustache)
* Alignment: TrueNeutral. Formerly LawfulNeutral.
* Reason for Joining: He's trying to find a reason to live without warmongering. The GUAE once goaded him to return to his old living style, he refused. The moment he heard that Beowulf might be amongst the ranks of GUAE, he actively opposes them.
* Loyalty to Cosmos: Cosmos has convinced him that there IS a way to live without warmongering, so Axel is loyal to her just as long as she doesn't lie.
* Threat level to Melkor: Moderate-high. This guy's determination to NOT DIE is just first class, and he has always refused to go back to his old lifestyle (which would be beneficial to Melkor).
'''[[Main/ChronoCrusade Rosette Christopher]], Goddess of [[Main/ChurchMilitant Religious Militia]]'''
* Lesser Goddess
* Symbol: A pocket watch
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/TalesOfTheAbyss Jade Curtiss]], God of [[ColonelBadass Colonels]]''' (Jade Balfour, Jade the Necromancer)
* Demigod
* Symbol: Malkuth army symbol
* Alignment: LawfulGood (Arguably LawfulNeutral, or TrueNeutral with good tendencies)
* Reason for Joining: Wily is repeating his old sadistic practices. He's trying to prevent the GUAE from creating another Nebilim.
* Loyalty to Cosmos: He'd say a lot of nasty things to Cosmos, but it's just his way to show his affection and loyalty to her.
* Threat Level to Melkor: High. He's a very powerful mage, is skilled enough in close combat to not be a SquishyWizard or GlassCannon, and has enough strategic and millitary training to be as significant a threat off the battlefield as on it.
'''[[{{F-Zero}} Captain Falcon]], God Of [[MegatonPunch Very Powerful Punches]]'''
* Greater God
* Symbol: A golden falcon
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor: Very High. Not even Melkor can remain unharmed after a [[MemeticMutation FALCOWN PAWNCH]]!!!
'''[[ShadowHearts Yuri Volte Hyuga]], [[DidYouJustPunchOutCthulhu Godslayer]]''' (Rude Hero)
* Demigod
* Symbol: Magatama with a red jewel
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[{{Warhammer 40000}} Alpharius]], God of Cheap Bastards'''
* Lesser God
* Symbol: Green hydra on purple background
* Alignment: ChaoticNeutral
* Reasons for Joining: A chance to defeat the Ultramarines on the field of battle is a chance he will not pass up, but perhaps there is more to his allegiance then what first appears, perhaps he serves a darker master.
* Loyalty to Cosmos: Uncertain, one day he appears her staunchest ally, the other a possible spy, whatever he is, he is not to be trifled with.
* Threat Level to Melkor: Moderate. Melkor thinks he can turn him.
'''[[{{VinlandSaga}} Thorkell the Tall]], God of [[HornyVikings Vikings!]] [[BloodKnight People Who Love To Fight!]] [[BigGuy Giant Raiders!]] and [[CrazyAwesome Feats of Improbable Bad Assery!]]'''
* Lesser God
* Symbol: An Axe and a Giant Log
* Alignment: ChaoticNeutral with some Evil tendencies
* Reason for Joining: It's not because he opposes Evil, he doesn't. It's not because he is loyal to Cosmos, he isn't. It's because he loves the fight, the chance to carve his way through a horde of the strongest warriors ever created, to appraise and out perform his rivals on the side of good. If he finds his rivals fight better than his enemies, well [[HeelFaceRevolvingDoor he'll just find the better fight]]. Member of the BloodKnight brigade alongside his rival Zaraki Kenpachi.
* Loyalty to Cosmos: Zero, he fights for the glory of battle alone.
* Threat Level to Melkor:
'''[[{{S-Cry-Ed}} Kazuma]], God of [[PainfulTransformation Power Despite Pain]]''' (The Shell Bullet, Kazuya, [=NP3228=])
* Greater God
* Symbol: The Shell Bullet arm
* Alignment: ChaoticNeutral
* Reason for Joining: Those bastards in the GUAE remind him of the bastards he fought in life, and not caring how much it hurts, he joined the GUAG to help kick some ass.
* Loyalty to Cosmos: Cosmos found out about his desire to join, and promised him that if he insisted on going OneManArmy on the GUAE, at least let her know first, and she'd make sure the Medical Division was around in case he needed the help. He at first stubbornly said it wasn't necessary, but later told he appreciated it, and said that he wasn't much of a team player, but he would not turn against the GUAG for any reason. Cosmos told him that was fair enough.
* Threat Level to Melkor:
'''Game/MegaMan, God of [[MegaManning Power Replication]]''' (The Blue Bomber)
* Demigod (when not upgraded)
* Symbol: His blue helmet
* Alignment: LawfulGood
* Domain: City, Protection, Law, Good
* Reason for Joining: To fight Dr. Wily. It's ''[[HijackedByGanon always]]'' a Dr. Wily plot.
* Loyalty to Cosmos: They share enemies, and Cosmos approves of his technical pacifist ways, and besides when she pointed out it is possible for Wily to [[MegaManBattleNetwork reform]], he conceded the point, and he's loyal because it's the right thing to do.
* Threat Level to Melkor:
'''[[VagrantStory Ashley Riot]], Patron of {{Physical God}}s''' (Riskbreaker, The Reinforcements, [[WalkingTheEarth The Vagrant]])
* Lesser God.
* Symbol: [[http://www.rpgfan.com/pics/vagrant-story/wall-ashley02.jpg The Rood of Iocus]]
* Alignment: NeutralGood. Maybe.
* Reason for Joining: The GUAE tried to MindScrew him again. He's pissed, and wants to go OneManArmy on them again.
* Loyalty to Cosmos: After the aformentioned mind screwing was over, he signed up with her, knowing she and the GUAG would need "the reinforcements".
* Threat Level to Melkor: High.
'''HonorHarrington, Goddess of Space Navies'''
* Intermediate Deity
* Symbol: Her treecat Nimitz
* Alignment: LawfulGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
''' [[{{Touhou}} Flandre Scarlet,]] {{Ax Crazy}} {{Badass Adorable}} Extraordinaire'''
* Lesser Deity (in terms of influence), Greater Deity (in terms of power)
* Symbol: a complex crest composed of her jeweled wings and her wand superposed over a rune circle
* Alignment: not quite clear, due to complete insanity varies from ChaoticGood / ChaoticNeutral to ChaoticEvil.
* Reason for Joining: Same like Hong Meiling, she wants her sister Remilia, to be deified, first she has to beat down Dracula first. With Sakuya being forced to join the GUAE after deification, Flandre also feels a stronger drive to kick Dio's ass.
* Loyalty to Cosmos: Medium, since Cosmos lets her have her fun... somewhere. However... in any case Sakuya accidentally DIES, Flandre is going to get mad and wreak havoc.
* Threat level to Melkor: VERY HIGH. If Melkor ever gets on her bad side...
'''[[MegaManX Zero]], God of {{Badass}} and [[HairTropes Blonde Hair]]''' (The Crimson Hunter, The Bloody Maverick)
* ???? (Like he does with his hero status, he does not call himself a god. No one's really going to force the issue though)
* Symbol: A [[MegaManX stylized]] [[MegaManZero Z]] overtop of [[MegaManZX Biometal Model Z]]
* Alignment: ChaoticGood....when not in his "Awakened" state. ChaoticEvil when.
* Reason for joining: Most think he's just warming the seat for X. Little do most know is that Cosmos has promised to help find people that can repair Iris (and to curb her rage, Colonel) to full power and Memory. Getting answers from Wily is just icing on the cake really. Lastly, he confirms the GUAE as his enemy, and...
-> "I never cared about justice, and I don't recall ever calling myself a hero... I have always only fought for the people I believe in. I won't hesitate... If an enemy appears in front of me, I will destroy it!"
* Loyalty to Cosmos: This is the best option to keep that promise to that friend. And Cosmos reminds him of Ciel, as well as showing him '''[[{{Narm}} WHATHEISFIGHTINGFOOOOOOOOOOOOOOORRRRRR!!!!]]'''.
* Threat level to Melkor: High. This guy ''completely'' refuses to die and is powerful to the boot.
'''[[{{Daimos}} Kazuya Ryuuzaki]], God of [[MoCapMecha Karate/Kung Fu Robo Pilots]] and [[ThePowerOfLove Those Empowered By Love]]'''
* Lesser God
* Symbol: The head of Daimos
* Alignment: LawfulGood
* Reason for Joining: Defending Earth, justice and... the GUAE is threatening Erika. That he cannot have!
* Loyalty to Cosmos: Very high. Kazuya is a man full of optimism and believes in justice, and Cosmos is not a highly bigoted racist like a certain mortal general that made him sick, so he feels more comfortable on taking her orders.
* Threat Level to Melkor:
'''[[HerculesTheLegendaryJourneys Her]][[Disney/{{Hercules}} cu]][[IncredibleHercules les]], [[WorldsStrongestMan Pantheon's Strongest God]]''' (Heracles, Herc, [[FateStayNight Berserker]])
* Demigod
* Symbol: The nemean lion skin
* Alignment: ChaoticNeutral
* Reason for Joining: Somebody added one more labor to his Twelve Labors, making it Thirteen Labors. And that labor is assisting the GUAG!
* Loyalty to Cosmos:
* Threat level to Melkor: Varies, depending on which persona Herc is having for the day.
'''[[StreetFighter Zangief]], God Of SpinningPileDriver''' ([[RedBaron Red Cyclone]])
* Lesser God
* Symbol: The cape of Red Cyclone
* Alignment: LawfulGood
* Reason for Joining: FOR MOTHER RUSSIA!
* Loyalty to Cosmos: Cosmos didn't think of him and Russia as DirtyCommunist. So for Zangief, Cosmos is a great comrade!
* Threat level to Melkor: Medium.
'''[[Main/MortalKombat Sub-Zero]], God of [[Main/PopsicleSplat Destruction Through]] [[Main/KillItWithIce Freezing]]''' (Kuai Lang, Sub-Zero II)
* Lesser God
* Symbol: The Dragon Medallion
* Alignment: LawfulGood
* Reason for Joining: As another act to redeem the Lin Kuei, as well as looking for his brother Noob Saibot.
* Loyalty to Cosmos: Cosmos is an example of goodness that the Lin Kuei should follow if they want to be redeemed, so Sub-Zero is very loyal to her.
* Threat level to Melkor: High. Nearly as equal to Hyoga in terms of ice power, and he's not afraid to get gory about it. Besides, he was one of the remaining people that remained good/undefeated during the rise of Onaga (and even get more powerful), so that says a lot.
'''[[StreetFighter Chun-Li]], Goddess of [[KickChick Kicking]]''' ([[RedBaron The Strongest Woman In The World]])
* Lesser Goddess
* Symbol: A Qipao or her Lightning Kick
* Alignment: LawfulGood
* Reason for joining: Not only Melkor kidnaps the children she's taking care of, Bison is spotted amongst the GUAE ranks, thus Chun-Li enlists in opposition of him.
* Loyalty to Cosmos: Very high. As a police officer and firm believer of justice, it's the only way to go.
* Threat Level to Melkor: High. She's the first motivator to make ladies kick ass, which is dangerous for Melkor
'''[[FistOfTheNorthStar Rei]], God of [[AbsurdlySharpBlade Absurdly Sharp]] [[FingerPokeOfDoom Fingers]]''' (Star of Justice)
* Intermediate God
* Symbol: Several fingers with some cut motion marks
* Alignment: LawfulGood
* Reason for joining: "I'm the Star of Justice. I live and die for others."
* Loyalty to Cosmos: Cosmos accepted him in warm hands after his messy death and took care and guardianship of his mortal lover Mamiya. Also, based on the quote above, pretty high loyalty.
* Threat Level to Melkor: VERY HIGH. On the same level of Kenshiro, and had it not been due to that unfortunate accident with Raoh, he could've racked an equal amount of Melkor's {{Mook}}s.
'''[[Main/{{Trigun}} Vash]], God of [[Main/ImprobableAimingSkills Marksmanship]]''' (Vash the Stampede, The Humanoid Typhoon)
* Demigod
* Symbol: A silver [[RevolversAreJustBetter Revolver]]
* Alignment: ChaoticGood
* Reason for joining: To remove the $$60,000,000 bounty placed on him.
* Loyalty to Cosmos: And, officially joining the good guys is a nice way to do that, and Cosmos has already started working on that bounty problem of his, so he's loyal.
* Threat Level to Melkor: High. He's a walking disaster after all.
'''[[Main/FinalFantasyVII Cloud Strife]], God of [[Main/{{BFS}} Swordsmanship]]''' (Spiky, The SOLDIER)
* Greater God
* Symbol: His Buster Sword
* Alignment: ChaoticGood
* Reason for joining: To defend what he thinks is right, by his own feeling, not because someone told him to.
* Loyalty to Cosmos: [[DissidiaFinalFantasy Has fought on Cosmos' side before]].
* Threat Level to Melkor: Meklor considers him a wuss and doesn't place him high on his threat list. Wether he's underestmating Cloud or not remains to be seen.
'''[[Main/AvatarTheLastAirbender Sokka]], God of [[Main/{{PrecisionGuidedBoomerang}} Boomerangs]]''' (Meat and Sarcasm Guy, Wang Fire)
* Quasideity
* Symbol: Boomerang
* Alignment: LawfulGood
* Reason for joining: Sokka feels that Aang's lack of tactical skill could get him in trouble, so Sokka tags along to make sure the kid doesn't do something too reckless.
* Loyalty to Cosmos:
* Threat Level to Melkor: Moderate-Low, whilst only a normal, he TookALevelInBadass in the later stages of the war with the Fire Nation and has a fair amount of inventing and tactical prowess
'''Jackie Chan, God of Main/{{Improvised Weapon}}ry'''
* Lesser God
* Symbol: Fist, Foot, Chair, Table, Mop, Ladder, Microwave, Kitchen Sink etc.
* Alignment: NeutralGood
* Reason for joining: A chance to fight alongside BruceLee that he respects. And to prevent the GUAE to give everyone 'Bad Days'
* Loyalty to Cosmos: He's always fought for the good guys, so he joined her side to do that.
* Threat Level to Melkor: High. Since EVERYTHING can become a weapon around him.
'''[[Main/{{RatchetAndClank}} Ratchet]], God of [[Main/{{BFG}} Firepower]]'''
* Intermediate Deity
* Symbol: The [[Main/{{InfinityPlusOneSword}} RYNO]], although a wrench is also used.
* Alignment: NeutralGood (originally TrueNeutral)
* Reason for joining: Was kinda semi drafted into joining.....
* Loyalty to Cosmos: ....though he has been paid pretty good since he was here, and he happens to like the good guys (Cosmos especially), so SureWhyNot be loyal.
* Threat Level to Melkor: very high, to date his best weapons have been know as the RYNO (Rip You a New One) RYNO II, RY3NO (Rip You 3 New Ones), RYNOCIRATOR, RYNO IV, RYNO IV Extreme, RYNO 4-Ever, RYNO V, and the Omega RYNO V. all of which have been blacklisted by all sane and most insane people, the last 5 had their plans torn up and scatted and the last three could get you 10 life sentences in the worst prison imaginable just for talking about them. add to that the 100 or so OTHER weapons he has and you are looking at a [[Main/{{OneManArmy}} one lombax army]]. As long as either Gadgetron, Megacorps, [=GrummelNet=] or other companies still produce weaponry, Ratchet will always remain a massive threat. Then again, if Melkor becomes a customer...
'''[[Main/BabylonFive John Sheridan]], God of [[NukeEm Nukes]].'''
* Demigod
* Symbol: The BabylonFive insignia.
* Alignment: LawfulGood
* Reason for joining: The bad guys like WMD's too much, and use them on innocent people FAR too much. As God of Nukes, he's going to PayEvilUntoEvil (albeit within reason).
* Loyalty to Cosmos: Not explicitly loyaly, but he does respect her ideals and the side of good, so he's a team player.
* Threat Level to Melkor:
'''[[Main/{{Castlevania}} Simon Belmont]], God of [[Main/WhipItGood Whipping]]'''
* Demigod
* Symbol: Vampire Killer Whip, plus a Holy Cross nearby.
* Alignment: LawfulNeutral
* Reason for joining: Familial duty to destroy Dracula and his evil allies.
* Loyalty to Cosmos: Cosmos is the epitome of good that vanquishes the terrible night. Why wouldn't he be loyal?
* Threat Level to Melkor: Very high, as Simon has an incredible amount of experience taking down high-powered Dark Lords with very little equipment or high-level skill.
'''[[Main/JusticeLeague Shayera Hol]], Goddess of [[DropTheHammer Blunt Weaponry]]''' (Hawkgirl)
* Demigoddess
* Symbol: A morning star
* Alignment: LawfulGood
* Reason for joining: To fight the forces of evil... and to smash shit.
* Loyalty to Cosmos: A bit scornful of serving any god/dess (even though she is one), but at least Cosmos holds good in high regard and is not someone she minds helping out.
* Threat Level to Melkor:
'''[[Main/FateStayNight Cu Chulainn]], Lord of the [[Main/BladeOnAStick Spear]]''' ([[Main/EveryoneCallsHimBarkeep Lancer]])
* Demigod
* Symbol: Gae Bolg
* Alignment: LawfulNeutral, though he was originally ChaoticNeutral. He blames Main/TypeMoon for this shift (though not that he regrets it).
* Reason for joining: There'll be lots of unrestrained good fights!
* Loyalty to Cosmos: Just as long as Cosmos doesn't restrain him or betray him, he's cool with her. Thus far, she hasn't.
* Threat Level to Melkor:
'''[[Main/{{Donkey Kong}} Donkey Kong]], God Of [[Main/{{Abnormal Ammo}} Strange Ammo]] And Barrel Throwing'''
* Lesser God
* Symbol: A Barrel with the letters DK on it
* Alignment: LawfulGood (except when opposing Mario; then he is more on the evil side)
* Reason for joining: He and Mario don't get along much, but he can accept much bigger threats are their mutual foes, so he and Mario will be in EnemyMine against the GUAE.
* Loyalty to Cosmos: Cosmos accepted his willingness to join, as long as he is willing to put aside his hatred for now, and DK can do that, and Mario isn't all that worked up either, so he's fairly loyal.
* Threat Level to Melkor: Moderate. His weaponry is unconventional, but he has super strength and sizable clan of like-powered apes and jungle fauna to back him up, and unconventional weaponry is hard to prepare for.
'''[[Main/GuiltyGear Millia Rage]], Goddess of [[Main/PrehensileHair Weaponized Hair]]'''
* Demigoddess
* Symbol: The Assassin Syndicate logo, slashed down the middle
* Alignment: TrueNeutral
* Reason for joining: ZATO-1/Eddie's in the GUAE.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Vita]], Goddess of [[Main/DropTheHammer Hammers]]''' (Wolkenritter, The Iron Hammer Knight)
* Lesser Goddess
* Symbol: Her [[NiceHat hat]], with Graf Eisen nearby.
* Alignment: LawfulGood
* Reason for joining: Hayate Yagami's orders. and to test her worthiness as Guy's successor in wielding the Goldion Crusher.
* Loyalty to Cosmos: Her senpai (Guy Shishioh) has joined the cause, and she wants to drop the hammer on Melkor's face repeatedly, because her senpai would do no less, so yeah, she's sworn loyalty.
* Threat Level to Melkor: Moderate normally; High if the GUAE were to ever damage her hat and/or threaten Hayate.
'''[[Main/{{Gundam 00}} Lockon Stratos]], God of [[Main/FriendlySniper Sniping]]''' (Neil Dylandy, [[StupidSexyFlanders Stupid Sexy]] [[FanNickname Lockon]])
* Lesser God
* Symbol: Orange Haro with word bubble "Lockon, Lockon, Lockon"
* Alignment: TrueNeutral
* Reason for joining: To stop and defeat Ali Al-Saachez, but he's not doing it for [[ItsPersonal personal revenge anymore]], but because Ali is that dangerous to the community.
* Loyalty to Cosmos: She wants sick bastards like the one he fought stopped. He will fight for that cause, and joined hers.
* Threat Level to Melkor:
'''[[Main/GearsofWar Marcus Fenix]], God of [[ChainsawGood Chainsaws]]'''
* Demigod
* Symbol: Crimson Omen
* Alignment: NeutralGood
* Reason for joining: Rumor has it that the GUAE are recruiting Locust forces into their army.
* Loyalty to Cosmos: When he heard Simon was going to shove a drill up evil's ass, he signed up with Cosmos so he could do the same with his chainsaw.
* Threat Level to Melkor: Moderate; no powers, but has accomplished too much badassery to be marked "Low".
'''[[SuperDimensionFortressMacross Max Jenius]], God of [[MacrossMissileMassacre Missile Swarms]]''' (Max Sterling)
* Lesser God
* Symbol: UN Spacy Logo
* Alignment: LawfulGood
* Reason for joining: Because [[WordOfGod awesomeness incarnate]] is what he is, and it's always fought for good before.
* Loyalty to Cosmos: Even after ascension, he still doesn't want to see body counts like he saw during the Zentradi War to ever pile up again, and thus he's back in the fight, willingly aiding Cosmos' side.
* Threat Level to Melkor: High. While missiles pose little threat to Mekor, the sheer number might prove fatal.
'''[[VisionOfEscaflowne Van Fanel]], God of Angelic Beefcakes'''
* Lesser God
* Symbol: Angelic wings
* Alignment: LawfullGood
* Reason for joining: Duty, to protect his people and Hitomi.
* Loyalty to Cosmos: High. Respect her and her attempts to end the war.
* Threat Level to Melkor: Very High. Not only is he one hell of a swordsman, but he also has the [[HumongousMecha Escaflowne]], the "God of War" at his at his disposal.
'''[[RomanceOfTheThreeKingdoms Huang Zhong]], God of [[TheArcher Archery]]'''
* Lesser God
* Symbol: The flag of the Shu kingdom
* Alignment: NeutralGood
* Reason for joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[SaintSeiya Ikki]], current God of Rebirth''' (Phoenix, The Knight of Hope)
* Greater God
* Symbol: Phoenix
* Alignment: ChaoticGood
* Reason for Joining: He finds the current godly job boring and tiresome and he so loves a good fight. And since he hates evil with a passion, unleashing his anger on the GUAE seemed like an excellent idea.
* Loyalty to Cosmos: He respects her but does not swear loyality to anyone. He also likes to work alone. While that might be problematic, Cosmos has gladly accepted him due to sheer power, even tough some other members of the aliance are concerned with his constant power increase.
* Threat Level to Melkor: High to Extreeme...depending on how many times he ressurects and thus, doubles his power. Melkor ordered his troops to try not to kill him, but the result is an increasingly rising bodycount.
'''[[Main/MarvelUniverse Black Bolt]], God of [[Main/MakeMeWannaShout Voice Weapons]]''' (Blackagar Boltagon, King of the Inhumans)
* Intermediate God
* Symbol: His helmet on the Inhumans insignia.
* Alignment: TrueNeutral
* Reason for joining: The GUAE contains the likes of the Skrull or at least those who had the same mindset, and they threaten the Inhumans. As a King, Black Bolt must take action. Besides, fellow Illuminati IronMan, Reed Richards and DoctorStrange have joined, thus he also joins in the fray.
* Loyalty to Cosmos: Cosmos saved him from the hole that he created during [[WarOfKings his climatic battle against Vulcan]], and had gently reprimanded him of how insane his plan could be, and promised him a way to achieve his goal without a plan that insane. Black Bolt is interested.
* Threat level to Melkor: Moderate. Melkor would've put him in the 'Those hit with BadassDecay[=/=]{{Chickification}} List', but his inanely broken power is too dangerous to overlook.
'''[[Main/TokusouSentaiDekaranger Doggie Kruger]], God of [[Main/BadassFurry Badass Furries]]''' (Boss, The Guard Dog From Hell, [=DekaMaster=])
* Intermediate God
* Symbol: His S.P.D badge (the one with number 100)
* Alignment: LawfulGood
* Reason for joining: Helping out Tommy to lead the SPD in the battle against evil greater than the Alienizers, and cutting down hundreds of evildoers.
* Loyalty to Cosmos: Very High.
* Threat level to Melkor: Quite High. A powerful swordsman... and 'killing' him doesn't always guarantee his death.
'''[[GuiltyGear Potemkin]] and [[BlazBlue Iron Tager]], Gods of [[MightyGlacier Slow-As-Hell Powerhouses]]''' ([[RedBaron Red Devil]] (Tager))
* Lesser Gods
* Symbol: A triangular link between Zepp's Symbol, Sector Seven's Symbol and Tager's crest. They're huge.
* Alignment: LawfulNeutral
* Reason for joining: Both Zepp and Kokonoe have aligned themselves to the GUAG in order to defeat many of their enemies, including That Man, I-No, Terumi.
* Loyalty to Cosmos: Depends on their leaders. President Gabriel of Zepp gets along fine with Cosmos, so Potemkin's loyalty is assured. However, Kokonoe can get a bit moody and Tager's loyalty depends if Kokonoe really wants to stay.
* Threat level to Melkor: Medium. They're REALLY powerful. But they're slow as a molass...
'''[[Main/{{Halo}} The 7th ODST Battalion]], House of Defense Special Forces, Gods of [[ItsRainingMen Orbital Insertions]]''' (The Helljumpers)
* Demigod Squadron
* Symbol: [[http://images4.wikia.nocookie.net/halo/images/c/c4/7thODSTunitpatch.PNG]]
* Alignment: LawfulNeutral (Overall; individuals range across the Good and Neutral (except Neutral Evil) spectrums)
* Reason for joining: The GUAE have recruited the Covenant. Gunnery-Sergeant Buck's response to his troops? "You know the music, boys; time to dance!"
* Loyalty to Cosmos: Chain of command
* Threat Level to Melkor: Moderate; stand no chance against the GUAE's big names, but against the GUAE's {{Mooks}} the Helljumpers are virtually unstoppable.
'''[[Main/{{Warhammer40k}} Adeptus Astrates]], Ultimate Special Forces, Gods of [[SuperArmy Godly armies]]''' (Space Marines, Angels of Death)
* God Squadron
* Symbol: Crux Terminatus
* Alignment: Lawful Badass
* Reason for joining: To purge the filth of Chaos
* Loyalty to Cosmos: Chain of command
* Threat Level to Melkor: Extreeme. Melkor is scared of them, but luckily for him, they come in only occasionally and in small numbers. However, even then they butchered his forces.
'''[[XWingSeries Wedge Antilles]], God of {{Ascended Extra}}s and [[LaResistance The Rebellion]]''' (Rogue One, Wraith One, Commander Antilles, ''General'' Antilles, Red One, Wedgan'tilles(Slayer Of Stars), Blackmoon Eleven aka The Greatest Pilot Of All Time, "Veggies", "Lt. Kettch", "[[NewJediOrder Vader]]")
* Demigod. He's declined promotion so far. We'll see how long that lasts.
* Symbol: His helmet, complete with the little check marks. Since his squadrons followed him, they brought their two crests and the symbol of the Rebellion.
* Alignment: He checked LawfulGood on the form, but there are times when he finds the rules too arbitrary to bother with.
* Reason for joining: A chance to kick the Empire's ass
* Loyalty to Cosmos: As long as they share enemies (which is more or less a given), he and his forces shall serve her.
* Threat Level to Melkor: not that high by themselves, but they pose a huge threat to the Death Star. Not to mention, Wraith Squadron's shenanigans make the Emperor, Darth Vader, and the 501st very, very nervous...
'''[[SailorMoon Tuxedo Mask]], God of [[MysteriousProtector Mysterious Protectors]]''' (Mamoru Chiba, Darien Shields, Moonlight Knight, Prince Endymion)
* Lesser God
* Symbol: a rose, mask and top hat
* Alignment: ChaoticGood
* Reason for joining: To protect and assist Sailor Moon.
* Loyalty to Cosmos: As he knows from personal experience (having been used by evil briefly during a MindScrew and mostly fighting against it), it needs a champion to oppose it, and since Cosmos is the epitome of the good Sailor Moon would fight for, he pledged his services.
* Threat Level to Melkor: Low-Moderate in direct combat, since most of Melkor's minions' defenses are sufficient to block precision rose throwing; he's mostly dangerous in the sense of being key to the motivation and mental health of Sailor Moon, who is a much heavier hitter. Has the potential to be more of a moderate-high threat if he ever taps into his potential or starts using armor and a sword, but that happens very rarely these days.
'''[[{{Gargoyles}} Goliath]], God of [[HurtingHero Emotionally Wounded Heroes]]'''
* Demigod
* Symbol: Clawmarks in stone
* Alignment: NeutralGood.
* Reason for joining: He and his clan initially wanted to remain neutral, but he couldn't stomach the thought of criminals hurting the innocent, and neither could they, so he offered his services.
* Loyalty to Cosmos: Fairly strong. She made sure they'd have adequate backup (in case the sun or reasonable facsimilie shows up to ruin their efforts), and he in exchange pledged to help her stop the spread of their evil.
* Threat Level to Melkor:
'''ThePhantomStranger''', '''God of Mysteries'''
* Divine Level: Unknown. (It's a mystery.)
* Symbol: Blank eyes shadowed by the brim of a hat.
* Alignment: LawfulGood (though some people wonder...)
* Reason For Joining: The Phantom Stranger ''always'' shows up when a CrisisCrossover involving the supernatural happens. Though nobody knows exactly when, or what he will do, or when he will leave.
* Loyalty to Cosmos: Unknown, though Cosmos believes she can trust him.
* Threat Level to Melkor: [[RuleOfThree Also unknown]]. Many have their suspicions, but nobody knows for certain.
'''[[{{Warhammer 40000}} The Catachan Devil]], DeathWorld Incarnate'''
* Lesser Deity
* Symbol: Open maw with many, many fangs.
* Alignment: Chaotic Hungry
* Reason For Joining: With the call of Ibram Gaunt, Ciaphas Cain, and Leman Russ to war, the Catachan Jungle Fighters under their command brought the Catachan Devil with them.
* Loyalty to Cosmos: So long as it's well fed, it's happy.
* Threat Level to Melkor:
'''{{Bayonetta}}, Goddess of [[FetishFuelStationAttendant Fetish Fuels]]'''
* Lesser Goddess
* Symbol: Both her guns... with some hairs nearby.
* Alignment: TrueNeutral
* Reason For Joining: Those angels who slew the whole Umbra Witches are actually minions of Mildred Avalon (Jubileus was her decoy). Bayonetta feels an urge to punch her, and anyone who's allied with her, into the sun. The money's nice too, as well as a chance of fighting anything else other than angels.
* Loyalty To Cosmos: Cosmos protected her from Madame Butterfly's deal of 'Sacrifice Angels or I'll damn you to hell'. With new height of freedom to do what she wants, Bayonetta trusts her.
* Threat Level to Melkor: Moderate-high. Melkor knew how she could pull off things BeyondTheImpossible and if he's not careful, he ''might'' be the one who gets punched from Pluto to Sun. But, as of now the GUAE Intelligence Department have been researching ways to reapply Madame Butterfly's deal, in which Bayonetta would have no choice but to make a FaceHeelTurn, thus becoming their ally.
'''[[Main/MassEffect Legion]], Deity (Deities?) Of [[Main/MindHive Mind Hives]]'''
* Demideity (or Demideities?)
* Symbol: a piece of N7 armor. Alternately, the [[Main/{{BFG}} M-98 Widow]] [[Main/SniperRifle Anti-Materiel Rifle]]
* Alignment: True Neutral
* Reason for joining: Joined because the 'Old Machines' and the heretic Geth joined the GUAE.
* Loyalty to Cosmos: The 'Old Machines' joined the GUAE. Cosmos opposes the GUAE. Cosmos opposes the 'Old Machines'. Cooperation furthers mutual goals.
* Threat Level To Melkor: Moderate
'''[[MassEffect Urdnot Wrex]], God of [[ProudWarriorRaceGuy Proud Warrior Race]]s'''
* Demigod
* Symbol: A futuristic assault rifle
* Alignment: Chaotic Good
* Reason for joining: He thinks he'll get a good fight as well as believing that anyone who fights the GUAG is either stupid or on Melkor's payroll. Killing both is for the good of the universe. Gets along well-enough with other Blood Knights, though he is comparatively less reckless.
* Loyalty to Cosmos: Moderate. She's got a good cause to fight for and better enemies to fight against.
* Threat Level To Melkor: High. Not only is he a powerful warior by himself, being skilled in biotics and weaponry, he also leads an army of Proud Warrior Races that has been convinced to fight for their lives if they stick with him.
'''[[MassEffect Mordin Solus]], God of [[DeadlyDoctor Surprisingly Lethal Healers]]'''
* Demigod
* Symbol: The tattoo design upon his forehead
* Alignment: Neutral Good
* Reason for joining: Wishes to seek atonement for past actions. Also, GUAE uses reprehensible science. Unacceptable experiments. Unacceptable goals. Have to kill them.
* Loyalty to Cosmos: High. All life precious. Cosmos protects life.
* Threat Level: Seen as Low. Much more dangerous than that. Easily underestimated.
'''[[Main/OnePiece Roronoa Zoro]], God of DualWielding and CutlassBetweenTheTeeth''' (Pirate Hunter, Mr. Bushido, Kenshi-San, Demon Cutter Zoro, Supernova)
* Intermediate God
* Symbol: 3 Swords, or Green Dragon, his jolly roger
* Alignment: Chaotic Good
* Reason for joining:
* Loyalty to Cosmos:
* Threat Level To Melkor:
'''[[{{Pokemon}} Zubat]], [[GoddamnedBats God...damned Bat]]'''
* Quasideity (yeah, right)
* Symbol: An EyelessFace and a pair of bat fangs
* Alignment: [[strike: Chaotic Evil]] True Neutral
* Reason for joining: As a pokemon, is loyal to Poke-[[TheMessiah Messiah Ash]], who joined. Zubat simply followed.
* Loyalty to Cosmos:Chain of command, and besides, Zubat knows that it has no chance of becoming Crobat if gets a trainer as unfriendly as one of the GUAE.
* Threat level to Melkor: Medium low. Extremely annoying to any of Melkor's minions, at the very least.
'''[[Main/KamenRiderDecade Tsukasa Kadoya]], God of [[ShapeshifterWeapon Using allies]] [[BodyHorror as Weapons ]]''' (KamenRiderDecade, Decade, Destroyer of Worlds)
* Lesser God (due to calling in favours)
* Symbol: The Kamen Rider Decade Symbol
* Alignment: Chaotic Good
* Reason for joining: Has journeyed throughout many worlds and saw Melkor's antics. Personally, he's ticked and decides to oppose him.
* Loyalty to Cosmos: High. Has learned a lot about loyalty thanks to staying in the Toku Base and his journeys with Yuusuke Onodera and Natsumi Hikari.
* Threat Level to Melkor: High. The man is many opposing heroes rolled up in one. Then there's his title and he pretty much lived up to it.
* Message to the GUAE: "Just a passing through KamenRider. Remember it well!"
'''[[Main/SuperRobotWarsAlpha Baran Doban]], God of [[EpicFlail Flails]]'''
* Intermediate God
* Symbol: The Bemidoban, with its flail ready, and seemingly singing "Ware koso waaa... Ware koso waaa... BARAN DOBAN!"
* Alignment: NeutralGood
* Reason for joining: To show the pride of the reformed Balmar warriors.
* Loyalty to Cosmos: Cosmos has forgiven his crimes as a Balmarian who tried conquering the galaxy, so Baran is grateful.
* Threat level to Melkor: High. No one, not even Melkor, wants to get hit with a gigantic iron ball traveling in a speed faster than light...
'''[[Main/{{Warhammer 40000}} Ursarkar E. Creed]], God of [[Main/{{MaryTzu}} Tactical Geniuses]]'''
* Lesser God
* Symbol: Someone angryly yelling his name
* Alignment: Neutral Good
* Reason for joining: ???
* Loyalty to Cosmos: ???
* Threat level to Melkor: Extermely High
'''[[DragonQuest Erdrick]], God[[{{AFGNCAAP}} (dess)]] of [[HeroicLineage Heroic Lineages]]''' (Loto, [[SpellMyNameWithAnS Roto]], Hero, Three, [[HelloInsertNameHere Insert Name Here]])
* Greater God[[{{AFGNCAAP}} (dess)]]
* Symbol: A stylized bird of prey
* Alignment: LawfulGood in poltics, manner, and strategy, with forays into ChaoticGood [[KleptomaniacHero whenever s/he sees something valuable]]
* Reason for Joining: That Melkor guy sounds like a demonic Lord of Evil. After killing two and helping arrange for the death of a third, killing those guys is basically hir ''hobby''.
* Loyalty to Cosmos: High. She's a cosmic being of light and goodness who empowers and guides heroes. Erdrick obeys without question, and quietly wonders if its relevant that s/he has never seen Cosmos and Rubiss in the same place at the same time.
* Threat Level: Very, very, very high. S/he took out the seemingly all-powerful {{Evil Overlord}}s Baramos and Zoma ([[{{AFGNCAAP}} possibly by hirself]]), and has a legion of trained heroic descendants, each of whom is capable of doing much the same.
'''[[Main/MahouSenseiNegima Miyazaki Nodoka]], Goddess of [[TookALevelInBadass Taking A Level In Badass]]''' (Pudica Bibliothecaria, Honya)
* Lesser Goddess
* Symbol: Her Diarium Ejus
* Alignment: Lawful Good
* Reason for joining: She wasn't going to sit back and do nothing while Negi-sense and Yue got involved.
* Loyalty to Cosmos: Cosmos allowed Yue to read her mind, Yue is incredibly loyal to her... unless Negi-sensei says otherwise.
* Threat Level: Nodoka might be very capable, but in a fight she is rated low-medium. However, Melkor has a price on her head to motivate his armies if they spot her. Because as a support unit her artifact makes her an '''extreme''' threat to him. Many other members of the GUAE feel the same way. Nodoka is constantly being escorted places for this reason.
Is there an issue? Send a MessageReason:
None
Added DiffLines:
'''[[SailorNothing Shoutan Himei]], Goddess of Hope''' (Sailor Salvation, Sailor Nothing)
* Lesser Goddess
* Symbol: A heart-shaped pendant
* Alignment: NeutralGood
* Reason for Joining: She got pulled into doing it by forces beyond her control, so she went along with the plan hoping to never have to do it again once everything is all said and done. She also disagrees with the GUAE's ideals of war and suffering, and wants to make sure no-one else goes through what she has. Lastly, she wants to rescue [[ElfenLied Lucy]], one of her few friends, from the GUAE's control.
* Loyalty to Cosmos: High. Cosmos treats Himei with respect, kindness, and even some maternal affection, supports her against the Yamiko, has promised to help free Lucy from the GUAE's control, and has set Himei up with [[SailorMoon another group of Sailors]] to give her support, assistance, and companionship.
* Threat Level to Melkor: Extreme. Never never never give up.
'''[[ShadowTheHedgehog Shadow the Hedgehog]], God of {{Angst}}''' (Fake Hedgehog, Faux Ultimate Life Form)
* Lesser God
* Symbol: A silhouette of his head
* Alignment: ChaoticNeutral
* Reason for Joining: He had a dream in which [[DeadLittleSister Maria]] told him to.
* Loyalty to Cosmos: His angst has usually abated somewhat after helping the side of good, so his loyalty is surprisingly high, unless he suddenly gets backstabbed.
* Threat Level to Melkor: Shadow managed to defeat an army of invading darkness-aliens practically by himself. So yeah, reasonably High.
'''[[ShakuganNoShana Shana]], Goddess of {{Tsundere}}''' (The Flame-Haired, Hot-Eyed Hunter; Yukari Hirai)
* Intermediate Goddess
* Symbol: Nietono no Shana
* Alignment: NeutralGood
* Reason for joining: [[DivideByZero Existence itself]] hung on her decision to side with the GUAG.
* Loyalty to Cosmos: [[{{Tsundere}} "I-it's not like I'm doing this for her! Look at my reasons! That's all there is, got it?!"]]
* Threat Level to Melkor: High, with or without Yuji Sakai's help.
'''[[{{Main/Naruto}} Naruto Uzumaki]], God of [[{{Determinator}} Outraged Optimism]]''' (Number One Hyperactive Knuckleheaded Ninja, [[GratuitousJapanese Rokudaime Hokage]])
* Quasideity (...but he'll be a Greater God someday! [[VerbalTic Dattebayo!]])
* Symbol: A ''naruto'', the spiral-shaped garnish of a bowl of ramen. Of course!
* Alignment: ChaoticGood
* Reason for joining: If he could join the forces of Good and win, maybe he can both convince Sasuke to abandon his vengeful ways and be the next Hokage. Believe it, dattebayo!
* Loyalty to Cosmos: Pretty high. Naruto considers her a friend and promised to help her, and he ''never'' backs down on his word.
* Threat level to Melkor: Moderate-High. Naruto's not the sharpest kunai in the holster, but he packs a hell of a punch. Melkor would rather not have to face the power of a primordial daemon, and he also knows that the ''[[RazorWind Rasen]][[DeathOfAThousandCuts shuriken]]'' could really do a number on him if it hits.
'''[[GGundam Domon Kasshu]], God of the HotBlooded''' (King of Hearts)
* Lesser Deity
* Symbol: A King of Hearts card
* Alignment: ChaoticGood
* Reason for Joining: His hand BURNS RED AGAINST EVIL! Also, the GUAE would have no qualms about siccing the Devil Gundam on the innocent, and that pissed him off.
* Loyalty to Cosmos: Her forces helped him stop the GUAE from reviving the Devil Gundam, which he is rather grateful for, and thus his loyalty is fairly high.
* Threat Level to Melkor: High.
'''[[MobileSuitGundam Bright Noa]], [[GetAHoldOfYourselfMan Eternal Repairer of Wrongly Placed Emotions]]'''
* Lesser God
* Symbol: Londo Bell logo
* Alignment: LawfulGood
* Reason for joining: Keeping morale up.
* Loyalty to Cosmos: He helps Cosmos in making sure morale stays high, as he knows that sometimes even the good guys falter, and she appreciates the help.
* Threat level to Melkor: High. Bright is the reason why Melkor can't seem to break the morale of many of the GUAG members...
'''[[AvatarTheLastAirbender Katara]], Goddess of [[TeamMom Nurturing]]''' (Sugar Queen, Sweetness)
* Intermediate Goddess
* Symbol: Water Tribe crest
* Alignment: ChaoticGood
* Reason for Joining: Supporting Aang.
* Loyalty to Cosmos: Reasonably high
* Threat Level to Melkor:
'''[[SuperRobotWars Lamia Loveless]], Goddess of [[TinMan Emotionless Beings]] [[BecomeARealBoy Who Slowly Receive Human Emotions]]''' (W17, Lamia-chan)
* Lesser Goddess
* Symbol: Chibi Angelg (An angelic looking pink mecha with a bow and energy sword)
* Alignment: LawfulGood
* Reason for joining: One, to ensure that those like her are allowed to have free will, and two, to prove that Juergen's "victory" over her was truly a fluke.
** Extra reasoning: To defeat the GUAE's Cypha of Huckebein, not only for horribly wounding Signum the same way Juergen 'beat' her, reliving her of the bad memories, Lamia thinks her actions defiled the sacred name of 'Huckebein' which has been praised as one of the SuperRobots that defended the force of good, thus she's out to make Cypha pay.
* Loyalty to Cosmos: On being deified, a lot of Gods ''ridiculed'' Lamia on how she got 'beaten' by Juergen. Cosmos was one of the deities that kept believing and supporting her, giving her enough confidence to stand on her own. For that, she's grateful and placed her trust on Cosmos.
* Threat level to Melkor: Low. Used to be Moderate, but once Melkor learned about the incident with Juergen, he immediately puts Lamia into 'Those hit with BadassDecay[=/=]{{Chickification}} List' and thinks she'll never restore her status. Time will tell if Lamia could reverse that.
'''[[Main/FistOfTheNorthStar Kenshiro]], God of [[Main/TouchOfDeath Death Touches]] and [[Main/YourHeadASplode Body Explosion]]''' (Man with Seven Scars)
* Intermediate God
* Symbol: The Big Dipper/His Seven Scars
* Alignment: LawfulGood
* Reason for joining: The GUAE are villains who trample on the lives of the innocents... [[ThisIsUnforgivable Unforgivable!]]
* Loyalty to Cosmos: Cosmos showed him such compassion and kindness that made him cry TenderTears very genuinely. At that point, Kenshiro considers her someone worth swearing loyalty to.
* Threat level to Melkor: VERY HIGH. Considering how many body counts of GUAE {{Mook}}s Kenshiro has felled and popped their heads off... Melkor knows he's not going to be taken lightly.
'''[[CodeGeass Jeremiah Gottwald]], God of [[UndyingLoyalty Loyalty]]''' (Orange-kun)
* Lesser God
* Symbol: Anything orange
* Alignment: LawfulNeutral
* Reason for Joining: Many of the GUAE have no concept of loyalty or fealty, and this offends Jeremiah, who has cast his lot with those who do (for the most part) shed blood for one another. Also, Lelouch has joined, and Jeremiah is forever loyal, even after ascension!
* Loyalty to Cosmos: Asking the God of Loyalty on HIS loyalty on HIS chosen ally is foolish... [[CaptainObvious OF COURSE HE'S LOYAL!]]
* Threat level to Melkor: Moderate. Melkor pities him for not being loyal to him.
'''[[Main/SuperRobotWars Setsuko Ohara]], Goddess of [[BreakTheCutie Broken Emotions]]''' (Sexsuko)
* Lesser Goddess
* Symbol: The Glory Star logo.
* Alignment: LawfulGood
* Reason for joining: Nobody else needs to suffer like she has suffered.
* Loyalty to Cosmos: Cosmos promised to do what she could to keep her from enduring any more suffering. Touched, Setsuko joined the cause.
* Threat level to Melkor: Same like Shinji.
'''[[Main/FlameOfRecca Mikagami Tokiya]], God of {{Revenge}} Abandonment'''
* Lesser God
* Symbol: His water sword Ensui
* Alignment: NeutralGood
* Reason for joining: He wants to protect his friends, with most of the GUAE heavily siding on revenge, he knows their efforts are futile.
* Loyalty to Cosmos: As he also suffered various humiliations and ridicule in the same vein of Lamia, Cosmos has also encouraged Mikagami not to lose sight of his 'Do not pursue revenge' sight (against those who humiliates/ridicules him), and she was also one of the beings who made him let go of revenge in the first place, so he considers her someone to protect, and that's saying something on his loyalty.
* Threat level to Melkor: Low. Another one put on Melkor's 'Those hit with BadassDecay[=/=]{{Chickification}} List'
'''[[OnePiece Monkey D. Luffy]], God of Nakama, Pirates, Loyalty to "underlings"''' (Captain of the Sunny Go, Straw Hat, Supernova)
* Intermediate God (for now)
* Symbol: A skull and crossbones with his straw hat on top and a smile on the skull
* Alignment: ChaoticGood
* Reason for Joining: The GUAE tried to hurt his crew.
* Loyalty to Cosmos: She is nice to his {{Nakama}} and her own. Thus, high.
* Threat Level to Melkor:
'''[[StarTrekTheNextGeneration Jean-Luc Picard]], God of {{Face Palm}}s'''
* Lesser Deity
* Symbol: The Starfleet Symbol
* Alignment: LawfulGood
* Reason for Joining: To uphold the ideals of the Federation.
* Loyalty to Cosmos: High. She likes her stance on morality and upholding the dignity of all beings, civilizations, and cultures, not to mention she opposes despotism and inflicting suffering on others. In fact, he was so moved, he gave a [[PatrickStewartSpeech passionate speech]] in defense of her ideals.
* Threat Level to Melkor: High. His charisma and speechcraft are a definite problem for Melkor
'''CourageTheCowardlyDog, God of [[CowerPower Cowardice]]''' (Stupid Dog!)
* Quasideity
* Symbol: Eustace's frowning head
* Alignment: ChaoticGood
* Reason for joining: [[{{Catchphrase}} The things he does for love...]]
* Loyalty to Cosmos: Cosmos occasionally comes to him in the form of Muriel Bagge when Courage is lonely or scared. So obviously he's pretty loyal to her, [[CatchPhrase or his name is]] [[hottip:*:[[ThatGuyWithTheGlasses Tackanovahumpashirerickydickyhamstermasterpollywollywannabingbangsupercalifragilisticnickknackpaddywhackgiveadogabananafannafofrescahickorydickoryhocketypocketywocketyangelinafrancescathethird.]]]] [[CatchPhrase ... And thank goodness it isn't.]]
* Threat level to Melkor: Fairly high, if he's protecting his family. On his, own, Moderate-Low.
'''[[{{Bleach}} Byakuya Kuchiki]], God of [[AloofBigBrother Brotherhood]]'''
* Lesser God
* Symbol: Senbonzakura, his zanpakuto; cherry blossom petals
* Alignment: LawfulNeutral
* Reason for joining: The GUAE hurt his pride. That he cannot stand. And he must uphold the law too.
* Loyalty to Cosmos: Being loyal is a way to uphold the law, and Cosmos so far protected his pride.
* Threat level to Melkor: High.
'''[[Main/GunBuster Kazumi Amano]], Goddess of [[CoolBigSis Cool Big Sisters]]'''
* Lesser Goddess
* Symbol: Gunbuster in Arms-folded pose
* Alignment: LawfulGood
* Reason for Joining: Ryusei asked for her help, knowing the good guys need Super Robot {{Badass}} power on their side, and she was happy to help.
* Loyalty to Cosmos: Ryusei told her Cosmos was the leader of those doing the right thing, and her loyalty is pretty high, as she trusts his word on this.
* Threat Level to Melkor:
'''[[CardcaptorSakura Fujitaka Kinomoto]], God of [[HotDad Cool Dads]]'''
* Demigod
* Symbol: Glasses and a fedora
* Alignment: LawfulGood
* Reason for Joining: To help his daughter of one world and adoptive son of another out.
* Loyalty to Cosmos: High, since she's so nice to his daughter
* Threat Level to Melkor:
'''Main/PacMan, God of [[Main/BigEater Gluttony]]'''
* Intermediate God
* Symbols: Cherries, strawberries, oranges, apples...any kind of fruit, really
* Alignment: NeutralGood
* Reason For Joining: He may not even know he's joined. The recruiters simply set down a trail of white dots and an occasional power pellet, and here he is.
* Loyalty to Cosmos: Totally oblivious.
* Threat Level to Melkor: Low. Melkor [[DangerouslyGenreSavvy knows better than to keep power-up pills in his lair]].
'''Main/{{Kirby}}, God of Main/{{Extreme Omnivore}}s'''
* Intermediate God
* Symbol: A Warp Star
* Alignment: ChaoticGood (eating the entire Pantheon does not Lawful Good make)
* Reason for Joining: Same reason as Pac-Man, only substitute "white dots and power pellets" with "cake and candy".
* Loyalty to Cosmos: Same as Pac-Man, with the exception that as he had to fight a direct incarnation of evil in his mortal form, loyalty to one doing the same for the happiness of others is not something Kirby minds.
* Threat Level to Melkor: Very High. Melkor was about to write low when Kirby suddenly ate almost a third of the mooks in his army and absorbed their powers.
'''[[Main/AvatarTheLastAirbender Iroh]], God of [[SpotOfTea Tea]] and Main/{{Cool Old Guy}}s''' (General Iroh, Dragon of the West)
* Intermediate God
* Symbol: A teapot
* Alignment: NeutralGood
* Reason for Joining: Godot likes coffee, he likes tea. Together, TheyFightCrime!
* Loyalty to Cosmos: She likes tea and doing the right thing. Loyalty strong and confirmed.
* Threat Level to Melkor: Fairly high. Melkor's seen what Iroh can do when pushed.
'''Main/{{Popeye}}, God of Main/{{Trademark Favorite Food}}s''' (The Sailor Man)
* Greater God
* Symbol: A can of spinach
* Alignment: NeutralGood
* Reason for joining: A chance to team up with other legendary cartoon characters. And show the kids the virtues of eating spinach: It lets you beat up Evil with ease!
* Loyalty to Cosmos: Cosmos is supporting his Spinach for Kids campaign, and he sympathizes with her wish to eliminate all that is evil.
* Threat level to Melkor: Varies from Low to Very High, depending on the amount of spinach present.
'''[[Main/DoctorWho The Doctor]], God (and Lord) of Time''' (Theta Sigma, The Last of The Time Lords, The Oncoming Storm, Ka-Faraq-Gatri, Destroyer of Worlds, Bane of Nightmares, John Smith, The Lonely God, The Man Who Gives Monsters Nightmares, The Raggedy Doctor)
* Greater Deity
* Symbol: A Police call box with slightly oversized windows. Also the Holy Sonic Screwdriver.
* Alignment: Varies (Usually CG, NG, or LG, sometimes CN)
* Reason for Joining: In the words of his second incarnation: ''There are some corners of the universe which have bred the most terrible things. Things that act against everything we believe in. They must be fought!''
* Loyalty to Cosmos: Although it varies with each incarnation, his loyalty is never in question.
** Due to Time Travel, all 11 incarnations of the Doctor are a member of the GUAG.
* Threat Level to Melkor: EXTREME. To quote the doctor himself: '' I'm the Doctor and you're in the biggest Library in the universe. [pauses] '''Look me up.''' ''
'''[[Main/GaoGaiGar Guy Shishioh]]''' (Evoulder, God of Destruction, World's Strongest Cyborg), '''[[Main/TengenToppaGurrenLagann Kamina]]''' (Who The Hell Do You Think He Is?!), '''Gods of Courage'''
* Intermediate Gods
* Symbol: The Dai-Gurren Dan logo (flaming skull with Main/CoolShades), on top of a G Stone.
* Alignment:
** Guy: LawfulGood
** Kamina: ChaoticGood
* Reason for joining: To fight tyranny and cruelty, and to show Melkor who the hell they are and the true power of COURAGE.
* Loyalty to Cosmos: Of course they're loyal. [[CatchPhrase WHO THE HELL DO YOU THINK THEY ARE!?]]
* Threat level to Melkor: VERY HIGH. They both have undying spirits and tendencies to break the law of physics and nature using courage.
'''[[Main/TheLegendOfZelda Link]], God of Diversified Weaponry''' (The Hero of Time)
* Lesser God
* Symbol: The Triforce
* Alignment: Varying with each incarnation, but always good.
* Reason for joining: [[BecauseDestinySaysSo Because destiny said so]].
* Loyalty to Cosmos: Varies with each incarnation, but almost always moderate to high.
* Threat Level to Melkor: Placed fairly high due to the long list of super-powerful evils Link has vanquished.
'''[[Main/SuperRobotWars Sanger Zonvolt]], the God that Cleaves/Smites Evil!''' ([[SpellMyNameWithAnS Zengar Zombolt]])
* Intermediate God
* Symbol: His [[Main/{{BFS}} Colossal Blade]]
* Alignment: NeutralGood
* Reason for Joining: Does he even need a reason? Because EVIL MUST BE CLEAVED/SMITED!
* Loyalty to Cosmos: He's helping Elzam, he gets to smite/cleave evil, and Cosmos asked him to do for all that is good what he did for Sophia Nate and Earth. He's quite loyal.
* Threat level to Melkor: High. Several evil deities have been cleaved. Melkor knew his time might come.
'''[[{{Discworld}} Commander Samuel Vimes]], God of Policemen''' (Sam, Old Stoneface, His Grace.)
* Lesser God
* Symbol: A copper badge in the shape of a shield with the number 177 on it.
* Alignment: Chaotic Lawful Good.
* Reason for Joining: First, Carcer is among them, and he ''will'' be brought to justice for his crimes. Second, the GUAE tramples on law and order, and he's going to spread around his anger about that with a big shovel.
* Loyalty to Cosmos: He's loyal to enforcing the law and justice, not her (as he has a bit of contempt for serving any deity, even though he is one). However, he does realize the GUAE are threatening law and order, and is helping Cosmos because as a copper, it's what he supposed to do.
* Threat Level to Melkor: High. Sam has fought off beings of pure evil successfully with no other power than his own will, which concerns Melkor greatly.
'''[[{{Discworld}} Carrot Ironfoundersson]], God of [[Main/TheHero Heroes]]''' (Captain Carrot)
* Lesser Deity
* Symbol: The badge of the Ankh-Morpork City Watch
* Alignment: LawfulGood
* Allies: Commander Samuel Vimes (boss), Angua von Uberwald (girlfriend)
* Reason for Joining: The GUAE has broken the law, and Carrot has gone on record he will arrest ''THE ENTIRE GUAE'' and have them answer for their crimes, and Commander Vimes needs his help.
* Loyalty to Cosmos: Sympathetic to her, but mostly is following Commander Vimes' lead.
* Threat Level to Melkor: High.
'''[[{{Earthbound}} Ness]], God of {{Kid Hero}}es'''
* Lesser God
* Symbol: A Franklin Badge
* Alignment: NeutralGood
* Allies: [[{{Main/Mother3}} Lucas]], [[Main/AvatarTheLastAirbender Aang]].
* Reason for Joining: Buzz Buzz appeared to him in a dream and asked him to help.
* Loyalty to Cosmos: She opposes Giygas. No other reason needed to help her.
* Threat Level to Melkor:
'''{{Spider-Man}}, God of [[TheEveryman the Everyman Hero]]''' (Peter Parker, Spidey, Webhead)
* Intermediate God
* Symbol: Stylized spider
* Alignment: NeutralGood
* Allies: Captain America, Superman, Iron Man
* Enemies: Joe Quesada
* Reason for joining: With Great Power ComesGreatResponsibility. That, and he wants to demand that JoeQuesada retcons the horrid ''One More Day''.
* Loyalty to Cosmos: Cosmos considered Spidey's marriage with Mary Jane sacred and condemns Quesada's act for the RetCon due to personal reasons. Knowing that she's on his side, Spidey harbors strong loyalty to her.
* Threat level to Melkor: High. Just because he doesn't have that much fancy powers compared to others... he's [[LetsGetDangerous not to be taken lightly]].
'''[[Main/{{GhostInTheShell}} The Tachikoma]], Gods of [[Main/HeroicSacrifice Heroic Sacrifice]]'''
* mechanical Demigods
* Symbol: A grey bowling ball
* Alignment: LawfulGood
* Reason for Joining: To assist The Major.
* Loyalty to Cosmos: Chain of command.
* Threat Level to Melkor:
'''[[Main/DigimonAdventure Wizardmon]], God of {{Reverse Mole}}s'''
* Lesser God
* Symbol: His staff
* Alignment: NeutralGood
* Reason for Joining: The GUAE attacked Gatomon.
* Loyalty to Cosmos: High due to their shared altruism.
* Threat Level to Melkor:
'''[[ThePrincessBride Inigo Montoya]], God of [[BadassSpaniard Spanish Heroes]] and [[MyNameIsInigoMontoya Victory Against Odds Battles]]'''
* Demigod
* Symbol: His rapier thrusted on a board written: "{{Hello}}. MyNameIsInigoMontoya. YouKilledMyFather. PrepareToDie."
* Alignment: NeutralGood
* Reason for joining: Believes that someone working for the GUAE [[YouKilledMyFather killed his father]]. He wants his father back from that "son of a bitch."
* Loyalty to Cosmos: Inigo knows that Cosmos is good and is loyal to her. In exchange, Cosmos gave him the permission to do as his feelings decreed if he ever confronted his father's killer.
* Message for the GUAE: "{{Hello}}. MyNameIsInigoMontoya. YouKilledMyFather. PrepareToDie."
* Threat Level to Melkor: High. The fact that Melkor has the killer of Inigo's father means that he better [[strike:PrepareToDie]] give it all he got, ''especially if Inigo is in critical health''.
'''[[InglouriousBasterds The Basterds]], Gods of [[PayEvilUntoEvil Paying Evil Unto Evil]]'''
* Demigods
* Symbol: A bloody baseball bat
* Alignment: ChaoticNeutral
* Reason for joining: Both Red Skull and Swarm joined the GUAE. They're #2 and #5 on their list.
* Loyalty to Cosmos: They're content in their duty of killing members of the GUAE, even if Cosmos abhors their methods.
* Threat Level to Melkor: IF Red Skull and Swarm are to be believed, VERY HIGH. This is backed up by several bodies of their followers and the survivors from said assaults. Melkor too shudders from the very thought of Bear Jew.
'''[[Main/BlazBlue Hakumen]], God of {{Hero Antagonist}}s''' (The White Void, The Cold Steel, The Just Sword, [[spoiler:Jin Kisaragi]])
* Lesser God
* Symbol: [[{{BFS}} Ookami]], surrounded by eight Magatama
* Alignment: LawfulGood
* Reason for joining: [[spoiler:As an act of atonement for his crimes as Jin Kisaragi]]. Another reason is that... He is the White Void. He is the Cold Steel. He is the Just Sword. With blade in hand shall he reap the GUAE of this Pantheon and cleanse it in the fires of destruction! He is Hakumen! The end has come!
* Loyalty to Cosmos: Cosmos is the only person Hakumen won't be [[GoodIsNotNice a dick]] to. They go way back.
* Threat level to Melkor: High. He destroyed the Black Beast, that put him high enough on the threat list.
'''SpiderWoman, Goddess of [[HeroWithBadPublicity Heroes With Bad Reputations]]''' (Jessica Drew)
* Lesser Goddess
* Symbol: Her mask and her wig, with a spider nearby inside a green light.
* Alignment: NeutralGood
* Reason for joining: Cleaning up her bad reputation of being thought as The Skrull Queen. Besides, other than this Alliance, [[TheWoobie she had nowhere else to go]].
* Loyalty to Cosmos: Cosmos understands her situation and did not believe one bit of the bad reputations surrounding her (past or present). Jessica was very grateful for that.
* Threat level to Melkor: Low. Another one put on Melkor's 'Those hit with BadassDecay[=/=]{{Chickification}} List' (That, and Melkor can always put bad reps on her).
'''[[Main/BaldursGate Minsc and Boo]], God of [[JusticeWillPrevail Evil-Butt-Kicking]] ForGreatJustice'''
* Lesser God
* Symbol: Boo himself
* Alignment: ChaoticGood
* Reason for joining: Because he's always an ally of justice and goodness. Plus, in the GUAG, there's a lot of chance for '''[[JusticeWillPrevail BUTT KICKING. FOR GOODNESS!!!]]'''
* Loyalty to Cosmos: On deification, Minsc lost contact to his previous witches. Cosmos comforted him and offers herself to be his new witch. Minsc swore fealty. '''YOU HEAR THAT, EVIL!? MINSC HAS A NEW WITCH!! WOE IS YOU!!!'''
* Threat level to Melkor: Moderate-high. He used to hang around with the Bhaalspawn (who could've be a Greater God, but passed the opportunity). [[ArsonMurderAndJaywalking Boo also bit his eye and gets away with it once]]
'''Main/IndianaJones, God of [[Main/IndyPloy Instinct]], [[Main/WhyDontYouJustShootHim Just Shooting]]'''
* Demigod
* Symbol: Fedora and a Bullwhip
* Alignment: ChaoticGood
* Reason for Joining: All those ancient magical artifacts in the posession of the bad guys, which will become the property of the good guys when they win, make this archaeologist drool when he thinks nobody's looking. He also hopes to silence critics uncertain about the impressiveness of his latest adventure.
* Loyalty to Cosmos: She shares his concern with keeping every extremely dangerous ArtifactOfDoom out of the GUAE's hands,and he's pledged support because he has experience with finding them and dealing with those who try to stop him.
* Threat Level to Melkor: Moderate. His instincts served him well...too well
'''[[Main/StarWars Obi-Wan Kenobi]], God of [[Main/TheObiWan Mentors]]''' (Ben Kenobi, Old Ben, OB-1)
* Lesser God
* Symbol: A lightsaber
* Alignment: LawfulGood
* Reason for Joining: He's a Jedi, and the GUAE have Sith; it's pretty straightforward, really.
* Loyalty to Cosmos: The Sith are the upper ranks of the GUAE, and he told Cosmos he was assisting her because he know how to deal with the Sith. She's rather grateful.
* Threat Level to Melkor: Fairly high. Melkor knows of Kenobi's reputation.
'''[[Main/HalfLife Gordon Freeman]], God of [[Main/BadassBookworm Analytical Badassery]]'''
* Intermediate God
* Symbol: A crowbar
* Alignment: ChaoticGood
* Reason for Joining: The GUAE resemble the Combine in their oppressive ways; Gordon won't stand for that, and the people of his timeline's Earth are again depending on him.
* Loyalty to Cosmos: Gordon hasn't actually confirmed his loyalty, [[HeroicMime or said anything at all for that matter]], but Cosmos has assured everyone he's a solid member of the GUAG.
* Threat Level to Melkor: Moderate-High.
'''[[Main/RozenMaiden Suiseiseki and Souseiseki]], Twin Goddesses of [[MemeticMutation Meme Theory]]''' (Desu and Boku)
* Lesser Goddesses
* Symbol: Tangled vines
* Alignment: LawfulNeutral (Souseiseki), ChaoticGood (Suiseiseki)
* Reason for joining: For Souseiseki, because it's part of the Alice Game. For Suiseiseki, she wants to make sure that she can live in peace with her sisters, [[VerbalTic desu]].
* Loyalty to Cosmos: For Suiseiseki, her loyalty is just as high as her wish to protect her sister, while Souseiseki remains loyal as long as it suits the goals her father has set.
* Threat Level to Melkor: Varying between low and high depending on whether the two are together or not. Two targets are harder to hit than one, and one entrapping their opponent while the other attacks him can be a real bitch
'''[[Main/TengenToppaGurrenLagann Simon the Digger]], God of [[Main/ThisIsADrill Drills]]''' (Captain Garlock)
* Lesser God
* Symbol: The Core Drill
* Alignment: ChaoticGood
* Reason for Joining: Evil, as his high priest [[SuperRobotWars Tetsuya Onodera]] puts it, "Needs A Drill Up It's Ass"
* Loyalty to Cosmos: As long as Kamina-senpai is on the team, his loyalty is absolute.
* Threat level to Melkor: VERY HIGH. For the same reason as Guy/Kamina. Simon as well as the Dai-Gurren Brigade can also commandeer and combine all other mecha in the GUAG into a massive war machine.
'''[[Main/{{Berserk}} Guts]], God of [[Main/AntiHero Antiheroism]]''' (The Hundred-Man Slayer, The Black Swordsman)
* Demigod (but when the rage kicks in, he has the power of a Greater Deity)
* Symbol: The Dragon Slayer with the Brand of Sacrifice carved on its side
* Alignment: TrueNeutral
* Reason for joining: Vengeance on Griffith
* Loyalty to Cosmos: Just so long as Cosmos doesn't deny his chance of revenge against Griffith, he's okay with her. If not...
* Threat level to Melkor: According to Griffith, he's not to be underestimated when his rage kicks in. VERY HIGH threat in that case. Otherwise, high.
'''[[Comicbook/{{Batman}} Dick Grayson and Tim Drake]], God of Main/{{Sidekick}}s'''
* Lesser God
* Symbol: A yellow "R" with a black circle behind it
* Alignment: LawfulGood
* Reason for Joining: They're heroes, it's their job.
* Loyalty to Cosmos: See above. Also, Cosmos is ''the good guy leader''. They'd be a hypocrite not to be loyal.
* Threat Level to Melkor:
'''The SuperSentai, Celestial [[HenshinHero Transforming Heroes]]'''
* Demigods and Demigoddesses
* Symbol: A Sentai helmet
* Alignment: LawfulGood
* Reason for Joining: Their enemies are in the GUAE, they need no reason.
* Loyalty to Cosmos: Anyone who wants to fight evil, they have no problem allying with.
* Threat Level to Melkor: Extreme. Not due to strength (they are individually quite weak), but due to sheer numbers and [[{{Nakama}} teamwork potential.]] Between membership and followers from later seasons, spinoffs, related shows, and American versions, they number in the hundreds, if not thousands- and almost all have giant robots and powerful weapons and armor.
'''[[PowerRangers Tommy Oliver]], God of {{Sixth Ranger}}s''' (Dr. Tommy Oliver, Jeebus)
* Lesser God
* Symbol: Ranger helmet (either green, white, red or black)
* Alignment: LawfulGood
* Reason for Joining: Maybe, if he helps quash the forces of evil this one last time, Fate will finally let him retire and get back to teaching. [[spoiler: It won't.]]
* Loyalty to Cosmos: She's a good guy, and the forces of good need the help. He's loyal.
* Threat Level to Melkor: High. A close ally of the Super Sentai, and commands the American Ranger Battalion.
'''[[AvatarTheLastAirbender Zuko]], God of [[HeelFaceTurn Turning Good]]''' (The Blue Spirit, Lee, [[spoiler: Fire Lord Zuko]])
* Intermediate God
* Symbol: Fire Nation crest
* Alignment: all over the map, but finally settled on NeutralGood
* Reason for Joining: To convince his former co-God of Anti Villians, Victor Fries, that it isn't too late to turn away from evil.
* Loyalty to Cosmos: Fairly high. She promised to help him rebuild the Fire Nation as a force of good.
* Threat Level to Melkor:
'''[[{{Superman}} Superman]], God of Main/{{Superhero}}es''' (Clark Kent, Kal-El, The Man of Tomorrow, The Last Son of Krypton, The Man of Steel)
* Greater God
* Symbol: A shield with an "S" on it.
* Alignment: LawfulGood
* Reason for Joining: for Truth, Justice, and the American Way!
* Loyalty to Cosmos: Good Guy leader. Loyalty given.
* Threat level to Melkor: High. One of the biggest threats of evil who always oppose them. And ''never'' seems to get put off.
'''[[{{Firefly}} Malcolm Reynolds]], God of [[BigDamnHeroes Big Damn Heroism]]''' (Mal)
* Lesser God
* Symbol: A browncoat
* Alignment: ChaoticGood
* Reason for Joining: [[{{Nakama}} He may not be captain, but this is his crew.]]
* Loyalty to Cosmos: She's part of the crew.
* Threat Level to Melkor: Moderate - High. Mal and his crew are resourcefull and devious.
'''[[EvilDead Ashley J. Williams]], The God [[JerkAss With the Gun]]'''
* Greater God
* Symbol: Boomstick and Chainsaw
* Alignment: Chaotic [[strike: Good]] Guy With Gun
* Reason for Joining: They've got the necronomicon, and when he heard that he figured his participation was inevitable.
* Loyalty to Cosmos:
'''{{Madlax}}, Goddess of {{Extraordinarily Empowered Girl}}s''' (The Gatekeeper of Hell is All Alone, Kind Killer)
* Demigoddess
* Symbol: SIG P210-2
* Alignment: NeutralGood
* Reason for Joining: Vanessa's life is on the line.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/{{Warhammer40000}} Leman Russ]], God of Main/{{Space Marine}}s'''
* Intermediate God
* Symbol: Wolf's Head
* Alignment: ChaoticGood
* Reason for Joining: Sanguinius already had this obligation when Leman Russ deposed his brother, and besides, it's a good fight for a good cause.
* Loyalty to Cosmos: None. Leman Russ answers to the God-Emperor alone, and to hell with anyone who thinks they can tell him what is right.
* Threat Level to Melkor: High.
'''[[Main/{{Warhammer40000}} Vulkan (Primarch)]], God of Main/[[{{ScaryBlackMan}} Scary Black Men]]'''
* Intermediate God
* Symbol: White Salamander head facing left
* Alignment: LawfulGood
* Reason for Joining: Out of loyalty to the emperor.
* Loyalty to Cosmos: Moderate. He does have a high amount of respect for her though.
* Threat Level to Melkor: High for a combination of his combat prowess (kicking Dark Eldar ass even as a small child), the armies of scary black super soldiers he brings to the table, and for the high quality equipment he can arm his allies with.
'''[[Main/{{DawnOfWar}} Cyrus]], God of Main/[[{{DifficultButAwesome}} Hard to use but very powerful characters]]'''
* Intermediate God
* Symbol: Black Raven with a blood drop in it.
* Alignment: LawfulNeutral
* Reason for Joining: Out of loyalty to the emperor.
* Loyalty to Cosmos: High.
* Threat Level to Melkor: As long as he stays out of close combat, very high. The GUAE has become very paranoid after Cyrus joined the GUAG and after hearing of his legendary knack for slipping in undetected and slaying war gods.
'''[[Main/HayateTheCombatButler Hayate Ayasaki]], God of Main/{{Battle Butler}}s'''
* Quasideity
* Symbol: One of Nagi's crudely-drawn mangas
* Alignment: LawfulGood
* Reason for Joining: Orders from his Oujo-sama.
* Loyalty to Cosmos: Cosmos is like a kind mother figure Hayate has been denied for thanks to those foolish parents of his. So, he's also loyal to her, and Cosmos also tries to have her order not clash with his Ojou-sama's
* Threat Level to Melkor:
'''Main/{{Ciaphas Cain}}, Patron of {{Main/Accidental Hero}}es''' (HERO OF THE IMPERIUM!)
* Quasidiety
* Symbol: Commissarial cap
* Alignment: TrueNeutral
* Reason for Joining: He didn't want to, really, but was forced into it as a duty to the Emperor.
* Loyalty to Cosmos: Chain of Command.
* Threat Level to Melkor: High. Melkor knows better than underestimating well-known heroes, especially those at Cain's level.
'''Ferik Jurgen, Patron of [[Main/TheManWhoShotLibertyValance Unsung Heroes]]'''
* Quasidiety
* Symbol: His [[Main/{{BFG}} melta]]
* Alignment: LawfulNeutral
* Reason for Joining: Goes where Commissar Cain goes
* Loyalty to Cosmos: Whom the Commissar follows, so does he.
* Threat Level to Melkor: Low-medium. Despite feeling somewhat eerie around him, he still doesn't think Jurgen to be that much of a threat, unless there's a melta pointing right towards him, of course. Of course, he doesn't realize Jurgen's true powers, either...
'''[[Main/GauntsGhosts Commissar Ibram Gaunt]], God of [[Main/LittleHeroBigWar Unrecognized Heroism]]'''
* Demigod
* Symbol: Tanith First and Only badge
* Alignment: ChaoticGood
* Reason for Joining: On behalf of Saint Sabbat and the Emperor's will, he is joining the cause against evil, and even if the GUAE didn't personally piss him off to start with, he's a fair man, and their flagrant alliance with the forces of Chaos had, in his own words, ''pushed him''.
* Loyalty to Cosmos: Chain of Command, and he does respect (quite highly) Cosmos' disgust with all that is evil.
* Threat Level to Melkor: High. He kicked hell's arse ''personally'' three times. Now he's pissed.
'''[+[[Main/{{Disgaea}} Captain Gordon]], Defender of Earth!+]'''
* Demigod
* Symbol: Thursday the Robot
* Alignment: LawfulGood
* Reason for joining: [+Captain Gordon, Defender of Earth!+] doesn't need a reason to defend justice!
* Loyalty to Cosmos: [+Captain Gordon, Defender of Earth!+] will stick with Cosmos like a mud! Because that's what heroes do! '''HAAAAHAHAHAHAHAHAHA!!!!'''
* Message for the GUAE: "Fear not, fellow good men! [+Captain Gordon, Defender of Earth!+] eats the GUAE for breakfast!"
* Threat Level to Melkor: Medium-High.
'''[[Main/TheWorldEndsWithYou Beat]], God of [[Main/IdiotHero Do-Gooders Who Think Using Their Gut]]''' ([[spoiler:Daisukenojo Bito]])
* Lesser God
* Symbol: A skateboard
* Alignment: ChaoticGood
* Reason for Joining: Having been given a taste of the Dark Side, Beat later decided that he wasn't "down widdat", and returned to the side of good from which he started.
* Loyalty to Cosmos: He likes serving her. She's a walking reason to ''stay'' loyal to all that is good. [[spoiler: And he wants to protect Rhyme.]]
* Threat Level to Melkor: Low by himself, Medium-High when paired with Neku.
'''[[Main/{{FinalFantasyTactics}} Ramza Beoluve]], God of [[Main/NoGoodDeedGoesUnpunished Unfairly punished Heroism]]'''
* Lesser God
* Symbol: A medieval white lion facing to the right
* Alignment: Neutral Good
* Reason for Joining: He's had it bad and Melkor is making more heroes get punished for noble heroism. Ramza decides to put an end to this and make sure that goodness NEVER gets punished harshly.
* Loyalty to Cosmos: Cosmos never believed all those vindications on him and was the one to elevate him to the Pantheon in the first place. Ramza is grateful, even though he's not part of [[DissidiaFinalFantasy her main knights]].
* Threat Level to Melkor: High. [[AlmightyJanitor He's a mighty squire]] [[DidYouJustPunchOutCthulhu that kills Gods]]. What do you mean it's not dangerous?
'''SquirrelGirl, Goddess Of [[Main/{{Fun Personified}} Funny Heroes]]''' (Doreen Green, The Anti-Life, Slayer Of All That Breathes)
* Intermediate Goddess
* Symbol: A squirrel
* Alignment: ChaoticGood
* Reason for Joining: Hey, she beat Dr. Doom, didn't she? What threat could Melkor possibly pose?
* Loyalty to Cosmos: Why not?
* Threat Level to Melkor: Impossibly high, second only (and even then, possibly not even second) to Cosmos herself.
'''[[{{Main/GuiltyGear}} Sol Badguy]], God of [[{{Main/TheAtoner}} Atonement]]''' (The Guilty Gear, The Corrupted Flame, Frederick)
* Intermediate God
* Symbol: The Fireseal or the mark of the Gears
* Alignment: ChaoticGood
* Reason for joining: To put an end to Justice (not the ideal, the being) once and for all.
* Loyalty to Cosmos: While he respects Cosmos, he also made it known that he's not that much a team player and prefers working alone.
* Threat level to Melkor: High as of now. Would've been very high if he ever removes his limiter...
'''[[SoulNomadAndTheWorldEaters Gig]], God of [[NobleDemon Heroic]] [[OmnicidalManiac Omnicidal Maniacs]] and [[PersonOfMassDestruction Insanely Powerful]] [[TheGrimReaper Reapers]]''' (Master of Death, Commander of the World Eaters, Indestructible Gig, Vigilance)
* Greater God
* Symbol: A scythe with a red blade
* Alignment: Somewhere between ChaoticEvil and ChaoticNeutral
* Reason for Joining: The GUAE destroyed his [[TrademarkFavoriteFood hotpods]]. ThisIsUnforgivable!
* Loyalty to Cosmos: Meh. As long as she stays out of his way while he annihilates the idiots who dared cross the Indestructible Gig, he has no complaints.
* Threat level to Melkor: Considering that Gig has a track record of slaying very powerful gods and such a fearsome reputation that the GUAE's recruitent rates were halved and their desertion rates doubled [[OhCrap the moment he announced whose side he was on]], you bet your ass he's on the top of Melkor's shit list.
'''{{Daredevil}}, God Of Heroes with {{Disability Superpower}}s (The Devil of Hell's Kitchen, Matt Murdock)'''
* Lesser God
* Symbol: Two red Ds
* Allignment: LawfulGood
* Reason for Joining: The forces of good need help.
* Loyalty to Cosmos: She hasn't treated him as any less capable as those without physical infirmaties, and respects his courage. He's rather loyal.
* Threat Level to Melkor: Medium.
'''[[KingArthur Sir Lancelot]], God of [[HistoricalHeroUpgrade Heroes That Got Upgraded From History]]''' (Launcelot, Lancelot of the Lake, Lancelot du Lac, [[MontyPythonAndTheHolyGrail Sir Lancelot The Brave]], [[FateZero Berserker]])
* Lesser God
* Symbol: His sword Alondite
* Alignment: LawfulGood
* Reason for joining: Serving King Arthur. Little does he know, his liege has..."[[GenderFlip changed]]" over the years.
* Loyalty to Cosmos: Strong, as long as Arthur/Arturia also follows Cosmos.
* Threat Level to Melkor: Varies. At times, all he does are [[MontyPythonAndTheHolyGrail just wrecking Melkor's harmless parties and scratching a castle wall with his sword]]. At worst, [[FateZero he threw around electric poles as weapons, tots machine guns and can grab anything thrown at him and threw them back at his attacker]], making him of a VERY HIGH threat.
'''[[TheLegendOfZelda Midna]], Goddess of [[DarkIsNotEvil Non Evil Dark Characters]]''' ([[spoiler:Twilight Princess]])
* Lesser Goddess
* Symbol: The piece of the Fused Shadow she always wears
* Alignment: TrueNeutral, with NeutralGood tendencies
* Reason for Joining: Watching over Link.
* Loyalty to Cosmos: As long as Link serves Cosmos, she'll shall aid Link in serving Cosmos' cause.
* Threat Level to Melkor: Rather low due to her current shape and powers, but Melkor fears that she might get hold of all the artifacts she needs, drastically increasing her threat level.
'''[[{{Disgaea}} Etna]], Goddess of [[LittleMissBadass Prepubescent Badassery]] (Demon Lord Etna, Beauty Queen Etna)'''
* [[strike:Intermediate Goddess]] Beauty Queen
* Symbol: A Prinny
* Alignment: ChaoticNeutral
* Reason for joining: [[ForTheEvulz For the lulz]]. That, and so she can continue to pester Laharl.
* Loyalty to Cosmos: Weak. She could probably take Cosmos in a fight, if her power level were high enough.
* Threat level to Melkor: For now, Low. But Melkor knows that if she wanted, Etna could level-grind up to his level. He's keeping an eye on her...
'''[[{{Disgaea3}} Raspberyl]], Goddess of [[RebelliousRebel Rebellious Rebels]]'''
* [[Intermediate Goddess]]
* Symbol: Her text book
* Alignment: ChaoticGood
* Reason for joining: Because its the bad ass thing to do.
* Loyalty to Cosmos: Very high. Considers Cosmos a role model.
* Threat level to Melkor: Extreme for two reasons. 1. Her best friend (Mao) is a CosmicHorror grade overlord capable of destroying all of creation if pushed too far (harming her will piss him off). 2. She can actually hold her own against him.
'''[[Main/{{BlazBlue}} Ragna the Bloodedge]], God of [[Main/GoodIsNotNice Meanie Good Guys]]''' (The Grim Reaper, Rawrgna)
* Lesser God
* Symbol: His blade near the crest of the Azure Grimoire (fake), shadowed with shades of the Black Beast
* Alignment: ChaoticGood
* Reason for joining: Terumi is in the GUAE. He's out to kill him. Do the math.
* Loyalty to Cosmos: Cosmos was responsible in reforming Jin for him, thus earning Ragna's loyalty.
* Threat level to Melkor: Very High. He used to be the Black Beast, after all. And he can still tap onto its power.
'''[[GuiltyGear Ky Kiske]], God of [[KnightInShiningArmor Holy]] [[TheCape Knights]] and [[ChronicHeroSyndrome Chivalry]]''' (King of Illyria, Holy Knight)
* Lesser God
* Symbol: The Fuuraiken
* Alignment: LawfulGood
* Reason for joining: Preserving righteousness since it's his job, as well as taking down MANY GUAE members that has been proven irredeemable.
* Loyalty to Cosmos: Very High. If Cosmos stands for uncorrupted justice, Ky's loyalty is eternally confirmed.
* Threat level to Melkor: Medium. While he is a powerful fighter, Melkor considers him 'too predictable', thus easy manipulation target.
'''[[FinalFantasyIV Kain Highwind]], God of [[HeelFaceRevolvingDoor Constantly Switching Between Good And Evil]]'''
* Lesser God
* Symbol: Baron's Dragoon batallion flag
* Alignment: LawfulGood, but often pegged as TrueNeutral due to his constant 'betrayals'
* Reason for joining: To finally fight on the good side from start to finish, thus showing other Gods that just because he switches sides a lot, doesn't mean he LIKES IT.
* Loyalty to Cosmos: High. Cosmos never believed that he just loves switching sides for the heck of it and entrusted him as a true force of goodness.
* Threat level to Melkor: Medium. While he doesn't have fancy moves or such, his will has become indomitable that he cannot be truly swayed to the other side. [[spoiler:And on occasions that he switches sides, he usually ends up as TheMole.]]
'''Main/CaptainAmerica, God of Justice and Head of Defense''' (Cap, Steve Rogers)
* Intermediate God
* Symbol: The American Flag; razor-edged [[PrecisionGuidedBoomerang boomerang]] shield
* Alignment: Good - there are arguments for both Lawful and Neutral.
* Reason for joining: To defend America and assist his old buddy Iron Man.
* Loyalty to Cosmos: Loyalty is part of the virtues of America, so he's loyal.
'''[[OrderOfTheStick Miko Miyazaki]], Goddess of {{Lawful Stupid}}ity'''
* Quasideity
* Symbol: An Ass with a Tree Growing out of it
* Alignment: [[Main/{{LawfulStupidChaoticStupid}} Lawful Stupid]]
* Reason for Joining: Her alignment and character class require it.
* Loyalty to Cosmos: See Reason For Joining.
* Threat Level to Melkor: Moderate. Her character class makes her increadibly persistant
'''[[MachineRobo Rom Stoll]], God of Justice Speeches & Interruptions'''
* Lesser God
* Symbol: The head of Vikung-fu
* Alignment: LawfulGood
* Reason for joining: [[CatchPhrase You don't deserve to know his reasoning!]]
* Loyalty to Cosmos: He'd be a hypocrite if he preaches about loyalty a lot, but didn't have one, so he is very loyal to Cosmos.
* Threat Level to Melkor:
'''[[Main/ReadOrDie Yomiko Readman]], Goddess of Records''' ([[PaperMaster The Paper]])
* Lesser Goddess
* Symbol: A book...any book
* Alignment: NeutralGood (TrueNeutral if it involves books and not people she cares about.)
* Reason for Joining: Every good battle makes for a good story, and Yomiko wants to be the first one to read about it...over and over and over again.
* Loyalty to Cosmos: High, since finding out that Cosmos likes to read
* Threat Level to Melkor:
'''[[Main/{{Stargate SG-1}} Daniel Jackson]], God of [[{{Omniglot}} Communication]]'''
* Quasideity
* Symbol: Sun over Pyramid
* Alignment: NeutralGood
* Reason for Joining: so many different people, from so many different points in both space and time, someone has to translate for everyone else.
* Loyalty to Cosmos: Her Disciple, has had many a conversation with her regarding the nature of good and evil. Often tries to decipher her cryptic riddles, 'if the candle is lit, the meal was cooked long ago'.
* Threat Level to Melkor:
'''[[Main/{{Stargate SG-1}} Samantha Carter]], Goddess of Sane Science'''
* Quasideity
* Symbol: SG-1 badge superimposed on an exploding star
* Alignment: LawfulGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MahouSenseiNegima Yue Ayase]], Goddesses of [[Main/TeenGenius Intelligent]] [[Main/BlackMagicianGirl Magical]] [[Main/XanatosGambit Strategy]]''' (Philosophastra Illustrans)
* Lesser Goddess
* Symbol: Juice Box
* Alignment: LawfulGood
* Reason for Joining: She arrived as one of Negi's support mages... and love interests.
* Loyalty to Cosmos: Whom Negi follows, so does she.
* Threat Level to Melkor: Moderate. She's no powerhouse but she's got the textbook equivalent of the Internet at her fingertips and is pretty handy on a broom.
'''[[GreatTeacherOnizuka Eikichi Onizuka]], Great Teaching God''' (Great Teacher Onizuka, GTO)
* Greater God
* Symbol: His motorcycle, complete with a plate with the number "22" on it
* Alignment: ChaoticGood
* Reason for Joining: Protecting his students from the REAL bad guys.
* Loyalty to Cosmos: Loyal. Even though Cosmos has sometimes responded to his 'advances' with a bit of violence (and that's usually if Onizuka goes too far, which he quickly apologizes)
* Threat Level to Melkor: Moderately high. Those suplexes hurt like a mofo.
'''[[Main/{{X-Men}} Jean Grey-Summers]], Former Goddess of Life and Rebirth''' (Phoenix)
* Greater Goddess
* Symbol: The X-Men logo
* Alignment: NeutralGood
* Reason for Joining: Teaming up with SpiderMan in her wrath against whoever it was that [[DroppedABridgeOnHim dropped a bridge on her]].
* Loyalty to Cosmos: Cosmos also condemns Quesada's acts for Jean's abrupt bridge-dropping, so Jean does like her.
* Threat Level to Melkor: currently none
'''[[Main/DirtyPair Kei and Yuri]], Goddesses of [[WalkingDisasterArea Destruction]]''' (The Dirty Pair, Main/LovelyAngels (Those who wish to avoid their wrath are advised to use the latter term))
* Greater Goddesses
* Symbol: WWWA Logo
* Alignment: ChaoticNeutral
* Reason for Joining: Unknown
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/AssassinsCreed Altaïr ibn La-Ahad]], God of [[Main/CareerKillers Assassins]]''' (Assassin, Desmond Miles)
* Demigod
* Symbol: [[http://image.hazardstrip.com/ico/sprays/ac_logo.png A weird 'A' thing]]
* Alignment: NeutralGood
* Reason for Joining: His hit list includes everyone in the GUAE.
* Loyalty to Cosmos:
* Threat Level to Melkor: Low until he check's off everyone from his hit list. Then it get's to EXTREME as his reputation explains for itself.
'''[[Main/ValkyrieProfile Lenneth Valkyrie]], Goddess of Creation''' (The Lord of Creation, Chooser of the Slain)
* Greater Goddess
* Symbol: A feather
* Alignment: NeutralGood
* Reason for Joining: To help Cosmos set things right by guiding fallen soldiers to the proper afterlife, where they can finally rest.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/{{Bleach}} Ichigo Kurosaki]], God of Psychopomp {{Shinigami}}''' (Strawberry)
* Lesser God
* Symbol: Zangetsu, and a bottle of Clorox
* Alignment: ChaoticGood
* Reason for Joining: He was a replacement for another guy who once held his position.
* Loyalty to Cosmos: As long as Cosmos lets him protect his friends, Ichigo is loyal to her. If she belittles them, he'll strike out on his own.
* Threat level to Melkor: Moderate. As long as Melkor could force him to do LeeroyJenkins moments in the name of his friends, he'd stay that way. Otherwise, high.
** Currently [[spoiler: depowered after using Mugetsu against Aizen]] on the Mortal plane. However, Melkor won't soon forget how he [[spoiler: delivered a [[CurbStompBattle one-sided beatdown]] upon Aizen after spending 3 months in the Dangai, and mastering his full power]]. Should Ichigo ever reach that level ever again, his threat level would be moved up to Extreme.
'''[[Main/SoulNomadAndTheWorldEaters Virtuous]], Goddess of Reverse Reapers''' (Master of Life, Layna the Firebrand, Layna the Venerable)
* Greater Goddess
* Symbol: Her staff
* Alignment: NeutralGood
* Reason for Joining: The GUAE would abuse the dead and the living alike for their own gain. The proper balance of the cycle of souls must be preserved...
* Loyalty to Cosmos: It's more of a partnership than anything else, but Virtuous has a lot of respect for Cosmos. It helps that their goals, methods, and ideals are quite similar.
* Threat level to Melkor: Significant. As long as Virtuous is alive, she can ensure that slain GUAE members reincarnate in weak vessels under the most inconvenient circumstances possible, and the reverse is true for the GUAG. Virtuous isn't the GUAG's strongest fighter, but Melkor has [[ShootTheMedicFirst made her destruction a top priority.]]
'''[[SuperRobotWars Kyosuke Nanbu]], God of [[NoOneCouldSurviveThat Improbable Death-Cheating]]'''
* Lesser God
* Symbol: The Alt Eisen Riese.
* Alignment: LawfulGood
* Reason for Joining: Easy access to top-of-the-line mecha, and the GUAE's willingness to hurt Lamia ''[[TranquilFury pissed him off...]]'', and the last one with Excellen '''''[[BerserkButton was even worse]]'''''. Melkor aims at both, so bet or not, he's in.
* Loyalty to Cosmos: The forces of evil is a tough force, but Kyosuke always has faith on Cosmos and the forces of Good. Besides, [[CatchPhrase he doesn't mind betting on the tough odds]].
* Threat level to Melkor: High. Melkor just can't seem to understand why he's always the bitch of luck when it comes with dealing with [[BornLucky Kyosuke]].
'''[[Main/TheKingOfFighters Mai Shiranui]], Goddess of [[Main/{{Fanservice}} Beauty]]''' (Ninja Hottie)
* Quasideity
* Symbol: a fan with a large red dot on it (similar to the flag of Japan)
* Alignment: NeutralGood
* Reason for Joining: A chance to get Andy Bogard to [[ObliviousToLove notice her]]. [[HighlyVisibleNinja Everyone else does...]]
* Loyalty to Cosmos: Moderate.
* Threat Level to Melkor: Moderate-Low. A decent fighter, but Melkor is always able to get around her charms.
'''[[Main/{{Naruto}} Jiraiya]], God of [[Main/{{Filth}} Smut]]''' (Toad Sage, Ero-sennin, Pervy Sage)
* Lesser God
* Symbol: Random Icha-Icha novel (Most likely a [[Main/LimitedSpecialCollectorsUltimateEdition special edition]])
* Alignment: ChaoticGood
* Reason for Joining: For the babes. Duh! That and the GUAE don't like his books.
* Loyalty to Cosmos: High. Jiraiya ''does'' have an altruistic side underneath it all.
* Threat Level to Melkor: Moderately Low normally. But Melkor is wary of how the rare times when Jiraiya [[LetsGetDangerous gets serious]], he's a threat worthy of High rating.
'''[[Main/TenchiMuyo Tenchi Masaki]], God of [[UnwantedHarem Harems]]''' (Being of Heaven and Earth)
* Demigod
* Symbol: A cabbit
* Alignment: NeutralGood
* Reason for Joining: Same reason as Jiraiya, though they [[MagneticHero come to him]], instead of the other way around.
* Loyalty to Cosmos: She didn't try to join the harem. Loyalty given.
* Threat Level to Melkor: Moderate normally; if any of his haremettes are threatened and he goes into full 13-dimensional mode, up to extreme.
'''[[Main/TenchiMuyo Kiyone and Mihoshi]], Goddesses of [[Main/HeterosexualLifePartners Girl Love]] [[{{Shipping}} Increased By Fanon]]'''
* Demigoddesses
* Symbol: A Galaxy Police badge
* Alignment: LawfulGood
* Reason for Joining: Aiding Tenchi Masaki
* Loyalty to Cosmos: Moderate-High. She's assisting them in hunting down the criminals they need to capture who have allied with the GUAE.
* Threat Level to Melkor:
'''Main/JamesBond, God of [[Main/AManIsNotAVirgin Womanizers]]''' (Mr. Bond, Agent 007)
* Lesser God
* Symbol: A martini...shaken, not stirred
* Alignment: ChaoticGood
* Reason for Joining: Her Majesty orders it.
* Loyalty to Cosmos: Chain of Command, and he personally believes Cosmos is a charming woman deserving of the loyalty she politely requested.
* Threat Level to Melkor: High. Bond's never met a BigBad he didn't kill.
'''[[Main/MagicalGirlLyricalNanoha Nanoha Takamachi]], Goddess of Friendship''' (The White Devil)
* Lesser Goddess
* Symbol: Raising Heart in pendant form
* Alignment: NeutralGood
* Reason for Joining: The GUAE made the worst mistake imagineable: they [[BerserkButton tried to hurt her friends]].
* Loyalty to Cosmos: Cosmos is her friend, so she's always loyal to her friend.
* Threat level to Melkor: High. That adorable look isn't fooling Melkor. He knows what she can do and why she's called The White Devil. [[DefeatMeansFriendship Which does include befriending the people she defeats.]]
'''[[Main/{{Disgaea}} Flonne]], Goddess of [[Main/LoveFreak Love Freaks]]''' (Angel Trainee, Fallen Angel)
* Demigoddess
* Symbol: A feather
* Alignment: Neutral ([[StupidGood Stupid]]) Good
* Reason for Joining: To spread the power of LOVE!
* Loyalty to Cosmos: Very High
* Threat Level to Melkor: Probably not high.
'''[[{{Mai-HiME}} Mai Tokiha]], Avatar of [[TheCaretaker Kindness and Compassion]]'''
* Lesser Goddess
* Symbol: Three magatamas encircled within a golden ring
* Alignment: NeutralGood
* Reason for Joining: She'd throw down her life to protect her friends on Earth (especially Mikoto and Yuuichi), but hopes that she doesn't actually have to ''give up'' her life.
* Loyalty to Cosmos: Moderate.
* Threat Level to Melkor: Low, as Mai doesn't like to fight all that much. If she's forced to summon Kagutsuchi, however, Melkor may be in a ''little'' bit of trouble.
'''[[{{Grenadier}} Rushuna Tendo]], Prophet of Smiles''' (The Smiling Enlightened, the Grenadier)
* Lesser Goddess
* Symbol: A smile on your face
* Alignement: LawfulGood
* Reason for Joining: Wants to spread smiles around the Pantheon and try beating the GUAE with those. If that should fail, [[GirlsWithGuns she's got other means]] of [[CooldownHug bringing them down]].
* Loyalty to Cosmos: Quite strong.
* Threat Level to Melkor:
'''[[Main/{{Naruto}} Hinata Hyuuga]], Goddess of [[Main/FanOfUnderdog Fans of the Underdog]]'''
* Lesser Goddess
* Symbol: A sunflower
* Alignment: LawfulGood
* Reason for Joining: "F-following N-N-Naruto-kun... I... I... guess..."
* Loyalty to Cosmos: Naruto's loyal to Cosmos, so Hinata is too. Also, Cosmos sometimes acts as a mother figure for the girl. High.
* Threat Level to Melkor: By herself, extremely low. Indirectly moderate as she can become a trigger for Naruto's threat level to escalate (just ask Pain).
'''[[MahouSenseiNegima Negi Springfield]], God of [[CuteShotaroBoy Juvenile]] {{Chick Magnet}}s''' (Negi-bozu)
* Lesser God
* Symbol: A deck of [[strike: 31]] 29 Pactio cards
* Alignment: LawfulGood
* Reason for Joining: It's the right thing to do.
* Loyalty to Cosmos: Cosmos promised him information on his [[MissingMom mother]] & [[DisappearedDad father]].
* Threat Level to Melkor: High due to magical skill and raw power.
'''[[SuperRobotWars Excellen Browning]], Goddess of [[TheTease Love Innuendo and Teasing]]''' (Ex-neesama, Miss Excell)
* Lesser Goddess
* Symbol: Chibi-Weissritter with a heart sign nearby. Or a set of bunny suit.
* Alignment: LawfulGood
* Reason for Joining: To be with Kyosuke, and to keep her friends Setsuko and Lamia from being hurt like she was by the GUAE.
* Loyalty to Cosmos: Even though Cosmos has always refused to go on a parade wearing bunny suit with her, Excellen is always loyal to her, because she knows Cosmos is good. Just as long as she doesn't start hitting on Kyosuke (which is unlikely)
* Threat Level to Melkor: Moderate. Would've been moderate-low, but Melkor was reminded that endangering Excellen would mean triggering the [[TranquilFury wrath of Kyosuke]], and Melkor knows Kyosuke is of High threat level. Melkor's proposed solution is to take her out when Kyosuke isn't looking.
'''[[FireEmblem Sain]], God of [[Main/ChivalrousPervert Chivalry and Courtship]]'''
* Demigod (pending class change to Paladin)
* Symbol: The flag of the Lycian League
* Alignment: ChaoticGood
* Reason for Joining: To impress the ladies with his chivalrious stance against evil!
* Loyalty to Cosmos: Cosmos is a good female, right? So of course he's loyal! And even if Cosmos is a male and Melkor is a female, joining evil would earn him the scorn of the ladies, so he's loyal.
* Threat Level to Melkor: Low... unless he is being watched by females, he gets stronger with more girls to show off for.
'''[[Main/PrinceOfPersia The Prince and Elika]], God and Goddess of Playful Romantic Banter'''
* Lesser God and Goddess
* Alignment: ChaoticGood / LawfulGood respectively
* Symbol: A raised eyebrow.
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[{{Ben 10}} Ben and Gwen Tennyson]], God and Goddess of [[RelationshipWritingFumble Unintentional Familial Subtext]]'''
* Lesser Deities
* Symbol: The Omnitrix (Ben); a spellbook (Gwen)
* Alignment: ChaoticGood and LawfulGood, respectively
* Reason for Joining: For Ben, it's to learn the secrets of and to gain control of the Omnitrix. For Gwen, it's to keep an eye on Ben.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[TalesOfTheAbyss Guy Cecil]] God of [[AllergicToLove Love Allergy]]''' (Gailardia Galan Gardios)
* Lesser God
* Symbol: The Jewel of Gardios sword
* Alignment: NeutralGood
* Reason for Joining: Serving in what he thinks is right. And getting over his gynophobia.
* Loyalty to Cosmos: Guy is loyal, but he is ''never'' seen in around at most 20 inches away from Cosmos.
* Threat Level to Melkor: Moderate-Low. Guy does try to get over his gynophobia, thus he may one day resist [[EvilIsSexy Melkor's female soldiers under The Baroness]].
''[[Main/CardCaptorSakura Sakura Kinomoto]], Goddess of Main/{{Magical Girl}}s'''
* Lesser Goddess
* Symbol: Her Star Wand, in key form
* Alignment: LawfulGood
* Reason for Joining: The GUAE wish to use the Clow Cards for evil and destruction; Sakura can't have that.
* Loyalty to Cosmos: She makes her feel all floaty inside!!
* Threat Level to Melkor: Moderate-High. Especially if Melkor messes with [[MamaBear her kid(s).]]
'''[[FinalFantasyIV Rydia]], Goddess of [[SummonMagic Summoned Beasts]]''' (Rydia of the Mist)
* Intermediate Goddess
* Symbol: A Mist Dragon
* Alignment: NeutralGood
* Reason for Joining: Helping fellow goddess Rosa.
* Loyalty to Cosmos: She, like Rosa, owes a lot to Cosmos, especially after the ''[[FinalFantasyIVTheAfterYears Creator incident]]''.
* Threat Level to Melkor:
'''[[FinalFantasyIV Rosa Farrell]], Goddess of WhiteMagic''' (Queen Rosa of Baron)
* Intermediate Goddess
* Symbol: Bow and Arrows
* Alignment: NeutralGood
* Reason for Joining: To assist both [[CombatMedic on the battlefield and in sickbay]].
* Loyalty to Cosmos: Absolute. She credits Cosmos for helping guide her earthly husband down the path to righteousness.
* Threat Level to Melkor:
'''[[Main/MagicKnightRayearth Hikaru Shidou, Umi Ryuzaki, and Fuu Hououji]], Triumvirate Goddesses of [[Main/MagicKnight Swords and Sorcery]]'''
* Demigoddesses
* Symbol: Mokona
* Alignment: NeutralGood (all three)
* Reason for Joining: The portal back to Tokyo is believed to be just beyond the [[SupervillainLair GUAE headquarters]].
* Loyalty to Cosmos: Varies among the trio, with Hikaru's loyalty being the strongest of them all.
* Threat Level to Melkor: VERY HIGH when the three of them are together. Hikaru herself is of High threat, but Umi and Fuu fell into Moderate.
'''[[http://en.marveldatabase.com/Stephen_Strange Doctor Strange]], God of Pure Sorcery, The [[AWizardDidIt Wizard Who Did It]]''' (Sorcerer Supreme, Stephan Strange, Master of the Mystic Arts)
* Greater God
* Symbol: Ankh, the Eye of Agamotto
* Alignment: NeutralGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MahouSenseiNegima Asuna Kagurazaka]], Goddess of [[Main/AntiMagic Anti Magic]]''' (Bellatrix Sauciata, [[spoiler: The Princess of Dusk, Asuna Vesperina Theotanasia Entheofushia]])
* Lesser Goddess
* Alignment: ChaoticGood
* Symbol: The two bells she wears in her hair.
* Reason for Joining: Where Negi goes, she goes.
* Loyalty to Cosmos: Likewise, who Negi serves, she serves.
* Threat Level to Melkor: High. Her abilities to shunt off magical powers make her a serious threat.
'''HarryPotter, God of FunctionalMagic''' (The Boy Who Lived)
* Intermediate God
* Symbol: A lightning bolt-shaped scar
* Alignment: NeutralGood
* Reason for Joining: Voldemort's part of the GUAE
* Loyalty to Cosmos: She serves good, and she wants to bring down Voldemort. Loyalty given.
* Threat Level to Melkor: Low.
'''[[{{Discworld}} Esmerelda Weatherwax]], Goddess of [[strike:Crones]]Mature Witches''' (Granny Weatherwax)
* Lesser Goddess (technically, an aspect of a greater goddess)
* Symbol: a 4000-horsepower broom
* Reason for Joining: She might not consider herself to be all that good a person, but she took one look at the GUAE, and said "I can't be having that.".
* Loyalty to Cosmos: She's helping Cosmos because she just can't stand the GUAE, and is grateful Cosmos hasn't treated her like a crotchety old crone.
* Threat Level to Melkor:
'''[[MahouSenseiNegima Jack Rakan]] The Other God of [[{{BFS}} Swordsmanship]]''' ("Rakan of the Thousand Blades" "The Ultimate Swordsman" "The Ultimate Mercenary" "The Ultimate Hard Worker" "The Man Who Cannot Die" "The Immortal Fool" "That Damn Guy Who You Can Stab With Swords All You Like And It Won't Do A Damn Thing, Damn it")
* Greater God
* Symbol: One Thousand Swords (His Artifact is "The Hero of a Thousand Faces")
* Alignment: ChaoticGood
* Reason for Joining: What, you think he'd miss out on all the fun?
* Loyalty to Cosmos: He's a good guy, Negi/Yue/Asuna need the help, but he mostly is doing this because he wants to. He does like Cosmos, though, and considers this alliance simply helping out his friends.
* Threat Level to Melkor: Very High. He doesn't [[ObfuscatingStupidity act like]] he'd be much of a threat, but Melkor knows what Jack's capable of.
'''Comicbook/{{Batman}}, God of [[Main/CrazyPrepared Preparations]]''' (The Dark Knight, The Goddamn Batman)
* Intermediate God
* Symbol: The Main/BatSignal
* Alignment: NeutralGood
* Reason for Joining: Because it's right. And because he's the '''''Goddamn''''' Batman.
* Loyalty to Cosmos: High.
* Threat level to Melkor: High. Same reason like Cap, and even bigger, since [[MemeticBadass Batman can beat mostly anyone if he has prep time]].
'''[[Main/{{StarTrek}} Spock]], God of [[Main/TheSpock Logic]]'''
* Demigod
* Symbol: The Vulcan Salute
* Alignment: LawfulGood
* Reason for Joining: It was the logical action for one who wishes to continue living in peace.
* Loyalty to Cosmos: High. She is an erudite being who shares a commitment to peace and the spread of knowledge.
* Threat Level to Melkor:
'''[[TheKarateKid Mr. Miyagi]], God of [[Main/TricksterMentor Trickster Mentors]]'''
* He's just a little old Demigod, yesirree...
* Symbol: his [[Main/{{Hachimaki}} rising sun headband]]
* Alignment: Main/ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat level to Melkor: [[SarcasmMode Yeah, look at his status... Not gonna be a threat...]]
'''[[Main/TheWorldEndsWithYou Neku Sakuraba]], the [[Main/IneffectualLoner Lonely]] [[Main/TheEmpath Empath]]''' ('[[HeadphonesEqualIsolation Phones]], The [[Main/FanNickname Anti-Sora]])
* Quasideity
* Symbol: A Player Pin
* Alignment: NeutralGood
* Reason for Joining: It was his prize for winning [[spoiler:TheGame]].
* Loyalty to Cosmos: Not very trustful of her, ever since his last encounter with [[spoiler:Joshua]].
* Threat Level to Melkor: Low by himself, Medium-High when paired with Beat.
'''TheAddamsFamily, Gods of {{Nightmare Fetishist}}s''' (Morticia, Gomez, Pugsley, Wednesday, and Uncle Fester)
* Demi-deities (Pugsley and Wednesday), Lesser Deities (the others)
* Symbol: Thing, a disembodied sentient hand
* Alignment: ChaoticGood
* Reason for Joining: The GUAE tried to kill Pugsley without inviting Wednesday. The family was not pleased.
* Loyalty to Cosmos: Cosmos is a bit... confused about their ideas of fun but does not bar them from it. Good enough.
* Threat Level to Melkor: High. They LOVE pain and are damn near NighInvulnerable.
'''[[Main/BlazBlue Jin Kisaragi]], God of [[{{Jerkass}} Assholes]]''' ([[spoiler:Hakumen]])
* Lesser God
* Symbol: Crest of the NOL, next to [[EvilWeapon Yukianesa]]
* Alignment: Currently something of a ChaoticGood ([[spoiler:Becomes LawfulGood when he is Hakumen]])
* Reason for Joining: He's marked as a traitor by the GUAE for leaving them due to their lack of attention to Ragna the Bloodedge. Also had a NearDeathExperience which eventually somewhat made him realize his faults of being an AnnoyingYoungerSibling and now he serves the good... [[spoiler:as Hakumen]]. Eventually, he had a genuine HeelFaceTurn and wholeheartedly becomes good.
* Loyalty to Cosmos: Cosmos was the one who saved him and made him realize (and repent from) his faults, as well as his eventual HeelFaceTurn, thus he's good with her.
* Threat level to Melkor: Medium. Yes, he was a needy brat, but Melkor witnessed him taking levels in badass...
'''[[Main/{{Persona 4}} Kanji Tatsumi]], God of JerkWithAHeartOfGold'''
* Lesser God
* Symbol: A folded chair
* Alignment: ChaoticGood
* Reason for Joining: To see if Jin is serious in his change of heart. And also [[EvenBadMenLoveTheirMamas protecting his mom]]
* Loyalty to Cosmos:
* Threat Level to Melkor: The Pantheon has similar atmosphere like both Dark Hour and Midnight Channel, meaning, Kanji could summon Persona at will. Melkor would say that he'd be Moderate, since he put up a damn of a fight against Izanami.
'''[[SengokuBasara Tokugawa Ieyasu]], God of Patience''' (Matsudaira Takechiyo)
* Intermediate God
* Symbol: Crest of the Tokugawa clan.
* Alignment: Lawful Good
* Reason for Joining: To prove that The Power of Bonds is invincible and can unite to achieve the greater good. Also, he wants to show Nobunaga the errors of his way (which he couldn't show back then since he was a JamesBondage extraordinary beforehand) and his grand mission to use The Power of Bonds to rescue the people within GUAE's Token Good Members and break the barrier between actual good members and Token Bad Guy Members.
* Loyalty to Cosmos: Cosmos believed in the Power of Bonds and keeps the line when Ieyasu is starting to stray off, so Ieyasu considers him a good friend.
* Threat Level to Melkor: High. He's quite the capable warlord, and no longer the guy who keeps getting kidnapped all the time. Recently went between high and very high, after [[Pantheon/BookOfTrope his successful attempt to raid the GUAE's Token Good Guy Members' prison and rescued TWO Goddesses]], showing of his charisma.
'''[[Main/CaptainPlanetAndThePlaneteers Captain Planet]], God of Nature''' (Our Hero)
* Intermediate God
* Symbol: The Earth
* Alignment: LawfulGood
* Reason for Joining: The GUAE is polluting nature, and he must stop them
* Loyalty to Cosmos: High. Her forces oppose the destruction and filth the GUAE plan to leave in their wake.
* Threat Level to Melkor: Moderate. All Melkor needs is to throw a lot of pollution on him and Captain Planet will be down. Still, if there's no pollution, Captain Planet is powerful on his own.
'''[[Main/AvatarTheLastAirbender Toph Bei Fong]], Goddess of [[DishingOutDirt Earth]]''' (The Blind Bandit, The Runaway)
* Intermediate Goddess
* Symbol: Winged Boar or Badgermole
* Alignment: ChaoticGood
* Reason for Joining: The GUAE tried to tell her what to do. NOBODY tells her what to do!
* Loyalty to Cosmos: Moderate. The world Cosmos wants to create is pretty boring to her, but since Cosmos isn't ordering her around, she's fine for now.
* Threat Level to Melkor: So long as she's on the ground or in contact with metal? HIGH. Anywhere else? Low-Medium. (Damn liar-detecting ability...)
'''[[Main/{{Bleach}} Shigekuni Yamamoto-Genryusai]], God of [[Main/PlayingWithFire Fire]]'''
* Intermediate God
* Symbol: Ryujin Jakka, his zanpakuto
* Alignment: LawfulNeutral
* Reason for Joining: It's the law, nothing more needs to be said!
* Loyalty to Cosmos: Cosmos follows the law, so he's in. If Cosmos breaks the law, he's out.
* Threat level to Melkor: Moderate. Yamamoto is mega powerful, but he's too attached to law, so Melkor just have to find a way to get around it.
'''[[Main/{{Naruto}} Temari]], Goddess of [[Main/BlowYouAway Wind]]''' (The Ninja Lumberjack)
* Intermediate Goddess
* Symbol: A giant paper fan
* Alignment: LawfulNeutral
* Reason for Joining: Because she's bored. Really. [[Main/SuspiciouslySpecificDenial Shikamaru's not part of the reason at all]].
* Loyalty to Cosmos: Low.
* Threat Level to Melkor: Mowing down entire forests? In a one swoosh? High.
'''[[Main/JusticeLeague Aquaman]], God of [[MakingASplash Water]]'''
* Intermediate God
* Symbol: A harpoon
* Alignment: Lawful Neutral/Good
* Reason for Joining: [[BatmanTheBraveAndTheBold Because this sounds like a fantastic adventure]]!
* Loyalty to Cosmos:
* Threat Level to Melkor: High. King of the Seas, remember?
'''[[Main/AvatarTheLastAirbender Aang]], [[Main/ElementalPowers Avatar Of The Elements]]''' (Kung-fu Action Jesus, The Avatar)
* Avatar of the Gods, an incarnation of the soul of the world
* Symbol: Airbender Tattoos
* Alignment: NeutralGood
* Reason for Joining: The GUAE threaten to upset the balance of the worlds; as Aang represents the spirit of these worlds, he can't allow that to happen.
* Loyalty to Cosmos: Pretty High
* Threat Level to Melkor: High
'''[[Main/YuYuHakusho Kurama]], God of [[GreenThumb Plants]]''' (Youko Kurama, Shuichi Minamino)
* Lesser God
* Symbol: A rose
* Alignment: ChaoticGood
* Reason for Joining: To defend his human mother.
* Loyalty to Cosmos: His human mother gets along smashingly with Cosmos. So, he'll hang around for awhile.
* Threat Level to Melkor: High. He's Batman masquerading as a pink-haired bishounen with plant powers.
'''[[Main/KingdomHearts Sora]], God of Light''' (Keyblade Bearer)
* Lesser God
* Symbol: A keyblade
* Alignment: LawfulGood
* Reason for Joining: Because its the right thing to do, and because as the Keyblade Master, he is needed if and when the GUAE commands the Heartless to attack.
* Loyalty to Cosmos: Fairly High
* Threat Level to Melkor: High, given that he can [[RuleOfCool cut apart skyscrapers]] and [[TheWarSequence take on 1000 Mooks.]] By himself.
'''[[Main/{{Naruto}} Shikamaru Nara]], God of [[Main/ShadowPin Shadows]]'''
* Symbol: A deer-shaped cloud
* Alignment: NeutralGood
* Reason for Joining: Don't feel like talking about it. It's such a drag...
* Loyalty to Cosmos: Chain of command.
* Threat Level to Melkor: Medium. Higher [[BrilliantButLazy when he's motivated...]]
'''Main/{{Tarzan}}, God of [[Main/NatureHero Nature Heroes]]''' (Lord Greystoke, The White Ape)
* Quasideity
* Symbol: The sound of his victory scream
* Alignment: NeutralGood with Chaotic leanings
* Reason for Joining: The GUAE tried to destroy his jungle and his animal friends.
* Loyalty to Cosmos: Very High. Her forces helped drive off the invaders.
* Threat Level to Melkor:
'''[[Main/MagicalGirlLyricalNanoha Fate Testarossa-Harlaown]], Goddess of [[ShockAndAwe Lightning]]'''
* Lesser Goddess
* Symbol: Bardiche in pendant form
* Alignment: LawfulGood
* Reason for Joining: Assisting Nanoha. And still hasn't given up in trying to reform Precia.
* Loyalty to Cosmos: Pretty High
* Threat level to Melkor: Moderate. Unlike Nanoha, Melkor has knowledge of what Fate can do, thanks to Precia. However, she's still too powerful to warrant a "Low" rating.
'''[[Main/TheMightyThor Thor]], God of [[ShockAndAwe Thunder]]''' (Thor Odinson, Donald Blake)
* Greater God
* Symbol: His hammer Mjolnir
* Alignment: Lawful Good
* Reason for Joining: Standing in to defend those threatened by those Evil Gods. Also, Melkor set his sights to Asgard, there's no way Thor is going to sit idly with it.
* Loyalty to Cosmos: Very high.
* Threat level to Melkor: Very high. Melkor knew Thor always held back and in his universe, he's still considered the strongest there is even while holding back...
'''[[Main/SaintSeiya Cygnus Hyoga]], God of [[Main/AnIcePerson Ice]]'''
* Lesser God
* Symbol: The Cygnus Constellation
* Alignment: LawfulGood
* Reason for Joining: To protect his liege Saori Kido/Athena, who is once again becoming the GUAE target.
* Loyalty to Cosmos: Loyal
* Threat Level to Melkor: With Aquariuses help? Very High.
'''[[TalesOfDestiny Judas]], [[YinYangBomb Molder of Light And Darkness]]''' (Leon Magnus)
* Intermediate God
* Symbol: His skull mask
* Alignment: TrueNeutral
* Reason for Joining: It's yet another step toward the completion of his atonement. This time, Cosmos vowed to make sure that it will be permanent and not deleted by time-fixing.
* Loyalty to Cosmos: Cosmos forgives him and didn't try to manipulate him, so he's loyal.
* Threat Level to Melkor: Moderate. He has the power to defeat Gods... but Melkor knows [[GlassCannon he takes hits like a girl]].
'''[[SamuraiShodown Nakoruru]], [[NatureSpirit Spiritual Protector of Nature]]'''
* Intermediate Goddess
* Symbol: Her pet falcon Mamahaha, holding her red ribbon
* Alignment: NeutralGood
* Reason for Joining: Same reason as Captain Planet.
* Loyalty to Cosmos: Very high, as Cosmos is also a part of Nature that she is protecting.
* Threat Level to Melkor: Moderate-High. She's less powerful than Captain Planet, but she lacked his weakness against pollution.
'''[[GhostRider Johnny Blaze]], God/Keeper of [[{{Hellfire}} Flames Of Hell]]''' (GhostRider, Spirit of Vengeance)
* Intermediate God
* Symbol: His [[FlamingSkulls FlamingSkull]] for head
* Alignment: TrueNeutral
* Reason for Joining: The formation of GUAE means he'll have lots of jobs to do in making them see their sins.
* Loyalty to Cosmos: Medium. The Ghost Rider works alone. And since Cosmos and the GUAG has rather little sins, he's okay with working with them (though he prefers solo missions)
* Threat level to Melkor: High. Ghost Rider is a very powerful being and just getting on his eyes could prove to be dangerous.
'''[[{{Disgaea}} Laharl]], God of Main/{{Noble Demon}}s''' (The Overlord)
* Intermediate God
* Symbol: A Prinny
* Alignment: LawfulNeutral (he insists it's ChaoticEvil)
* Reason for Joining: So he can take over the Pantheon once everyone lets their guard down. '''[[EvilLaugh HAAAHAHAHAHAHAHAHAHA!!!]]''' [[Main/SuspiciouslySpecificDenial And not because Flonne wanted to join this side. Really.]]
* Loyalty to Cosmos: He claims that he's not loyal and will eventually backstab her, but his acts say otherwise, as "It's what great overlords do"
* Threat Level to Melkor: Moderate. He's powerful on his own and can level grind, but Melkor always comes prepared with The Baroness to disable him with her sexy wiles.
'''Main/AstroBoy, God of [[Main/RidiculouslyHumanRobots Humanoid Robots]]''' (Mighty Atom, Tobio Tenma)
* Intermediate God
* Symbol: A heart of gold
* Alignment: LawfulGood
* Reason for Joining: It was built into his programming from day one.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/TokyoMewMew Ichigo Momomiya]], Goddess of Main/{{Catgirl}}s''' (Mew Ichigo, Momomiya-san)
* Lesser Goddess
* Symbol: The Strawberbell
* Alignment: LawfulGood
* Reason for Joining: As a protector of the Earth's future, she is at the service of Cosmos, nya! Aside from that, Aoyama-kun is also on board...somewhere.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/{{Darkstalkers}} Morrigan and Lilith Aensland]], Goddesses of [[Main/HornyDevils Succubi]]'''
* Demigoddesses
* Symbol: Bat wings
* Alignment: ChaoticNeutral
* Reason for Joining: Just for the fun of it.
* Loyalty to Cosmos: Not much, but they don't see much of reason to really help the GUAE either.
* Threat Level to Melkor: Low-Moderate.
'''[[Main/DungeonsAndDragons Drizzt Do'Urden]], God of [[Main/OurElvesAreBetter Elves]]''' (The Hunter, the Warrior Incarnate)
* Intermediate God
* Symbol: Twinkle and Icingdeath crossed
* Alignment: ChaoticGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/BreathOfFire Ryu]], Lord of Dragons'''
* Intermediate God
* Symbol: A pyramidal Dragon Gene
* Alignment: ChaoticGood
* Reason for Joining: His kin are being used as tools of war by the GUAE. Ryu cannot allow this.
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/MakaiKingdom Zetta]], Badass Freakin' Overlord of the Netherworld'''
* Greater God
* Symbol: The Sacred Tome (in which he is sealed)
* Alignment: ChaoticNeutral (post-sealing; previously ChaoticEvil)
* Reason for Joining: Someone knows of a way to restore his corporeal form, but he doesn't know who to trust...
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[Main/FateStayNight Medusa]], Goddess of GorgeousGorgon''' (Rider)
* Intermediate Goddess
* Symbol: [[strike:Her head with snake hairs]] Bellerophon, her Pegasus
* Alignment: ChaoticGood
* Reason for Joining: Protecting her Mistress. And her long awaited vengeance against Shinji Matou.
* Loyalty to Cosmos: Cosmos protected Sakura, so she by extension loyal to her.
* Threat level to Melkor: Moderate. Being freed from Shinji's tenure increased her threat level.
'''[[Main/GuiltyGear Dizzy]], Goddess of [[Main/FriendToAllLivingThings Benevolent]] [[Main/PersonOfMassDestruction Living Weapons]]''' (The Innocent Gear)
* Intermediate Goddess
* Symbol: Two wings, one white and concealing a beautiful goddess-like face, one black and concealing a malevolent-looking skull
* Alignment: NeutralGood
* Reason for Joining: Cosmos defended her from some GUAE members trying to capture her.
* Loyalty to Cosmos: Pretty high.
* Threat level to Melkor: By her nature, she'd be of high threat already.
'''[[Main/LordOfTheRings Gimli]], God of [[Main/OurDwarvesAreAllTheSame ISO Standard Dwarves]]''' (Son of Gloin)
* Intermediate God
* Symbol: A Dwarven Waraxe
* Alignment: LawfulGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor: Standard Medium
'''[[WaltDisney Mickey Mouse]], God of {{Toon}}s''' (King Mickey, Mortimer Mouse)
* Greater God
* Symbol: A silhouette of his head
* Alignment: LawfulGood
* Reason for Joining: To protect his kingdom, and because as one of the few Keyblade wielders, he's desperately needed if and when the GUAE use Heartless.
* Loyalty to Cosmos: Is returning the favor to Cosmos, after she gave him help in the form of some of her champions.
* Threat Level to Melkor: High. It is amazing what you can do with a [[{{Disney/Fantasia}} hat]], a [[KingdomHearts rather large Key]] and a [[EpicMickey paintbrush]] when [[LetsGetDangerous pressed.]]
'''[[{{Warcraft}} Thrall]], God of [[OurOrcsAreDifferent Orcs]]''' (Son of Durotan, Go'el, Warchief)
* Intermediate God
* Symbol: The emblem of the Horde
* Alignment: LawfulGood
* Reason for Joining: What better way is there to prove that the Orcs has redeemed themselves and is now a cultured, good race, than by opposing their evil creator Melkor?
* Loyalty to Cosmos: The Orcs used to be a backstabbing race, but not anymore, Thrall taught them loyalty, especially to Cosmos. "We don't do stupid things, like betrayals, just because someone said ''''FOR THE HORDE!!!''''"
* Threat level to Melkor: Thrall's supporter kept rising and rising... he could be a big threat to Melkor's orcs.
'''[[Main/MarvelUniverse Century]], God of [[Main/NewPowersAsThePlotDemands Superpowers As The Plot Demands]]'''
* Greater God
* Symbol: His battleaxe, Parralax
* Alignment: NeutralGood
* Reason for Joining:
* Loyalty to Cosmos:
* Threat Level to Melkor:
'''[[FateStayNight Arturia]], goddess of GenderFlip, AlternateCharacterInterpretation, and MirrorUniverse''' (Saber, KingArthur)
* Lesser Goddess
* Symbol: [[CoolSword Excalbur]] with an {{Ahoge}} in the background.
* Alignment: Originally LawfulGood, veering towards NeutralGood
* Reason for Joining: To finally try to be a good king, which means defending/caring about the common folk/innocent as well as fighting evil on principle
* Loyalty to Cosmos: Cosmos told her not to beat herself up over her past failings, and simply do her utmost to do better this around, and has promised to give her plenty of reminders on what to do just in case. In response, Saber's loyalty is pretty good.
* Threat Level to Melkor: Moderate. However, since Shura told her she can borrow the true Excalibur....Very High
'''[[{{Castlevania}} Adrian Fahrenheight Tepes]], God of {{Dhampyr}} and [[FriendlyNeighborhoodVampires Friendly Vampires]]''' (Alucard)
* Intermediate God
* Symbol: Dracula's symbol reversed.
* Alignment: NeutralGood
* Reason for Joining: Opposing his father, as always. For extra reasons, he's out to defeat Terumi Yuuki because he's a dangerous CompleteMonster, [[FantasticRacism ridicules vampires]], [[ArsonMurderAndJaywalking and tried spraying his house name into 'House of Shitty Vampires']]
* Loyalty to Cosmos: Cosmos is the force of good, so he trusts her.
* Threat level to Melkor: As the son of Dracula, Melkor knows how powerful he can be. So... high.
'''[[Main/{{DCComics}} Power Girl]], Goddess of [[Main/{{MostCommonSuperPower}} Improbable Figures]]''' (Kara)
* Lesser Goddess
* Symbol: Her chest through that infamous "boob window"
* Alignment: NeutralGood
* Reason for Joining: The Anti-Monitor, killer of her entire universe, is on the GUAE. For Kal-L, for Lois, for Jimmy, her worlds shall be avenged, and she must ensure that nobody else has to suffer the way she and hers had.
* Loyalty to Cosmos: Fairly High
* Threat Level to Melkor: High. He has lost many troops to her twin abilities of distraction.
'''[[Main/FateStayNight Rin Tohsaka]], Goddess of the Main/ZettaiRyouiki''' (Sorceress, She of the S-Grade Zettai Ryouiki)
* Demigoddess
* Symbol: a precious stone
* Alignment: LawfulNeutral
* Reason for joining: To make Shinji Matou pay for his AttemptedRape on her. Also, to watch out for Shirou and make sure he's not over doing it.
* Loyalty to Cosmos: She also is grateful Sakura was pulled out of harm's way, and wants to help out Saber, not to mention Cosmos worked out a deal with Robin Hood, Black Cat, and Cat Woman to provide her with some gemstones from time to time so she doesn't run low. Loyalty is moderate to moderate-high.
* Threat Level to Melkor: Moderate